Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_8496645g0010 |
Family | GH3 |
Protein Properties | Length: 112 Molecular Weight: 12065.1 Isoelectric Point: 10.4275 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH3 | 4 | 110 | 3.7e-29 |
MTQIIFGLQGQPPANSTKGVPFIAGQSNVAACAKHFVGDGGTTKGIDENNTVINYKGLINIHMTPYFDAIAKGVSTIMVSYSSWNGLKMHANRFLISHVL KKQLGFK |
Full Sequence |
---|
Protein Sequence Length: 112 Download |
VKAMTQIIFG LQGQPPANST KGVPFIAGQS NVAACAKHFV GDGGTTKGID ENNTVINYKG 60 LINIHMTPYF DAIAKGVSTI MVSYSSWNGL KMHANRFLIS HVLKKQLGFK VL 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PRK15098 | PRK15098 | 8.0e-9 | 1 | 110 | 110 | + beta-D-glucoside glucohydrolase; Provisional | ||
COG1472 | BglX | 8.0e-16 | 22 | 110 | 94 | + Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism] | ||
pfam00933 | Glyco_hydro_3 | 3.0e-23 | 25 | 110 | 89 | + Glycosyl hydrolase family 3 N terminal domain. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAZ15705.1 | 2.94273e-44 | 1 | 110 | 192 | 301 | endo-alpha-1,4-glucanase [Gossypium hirsutum] |
GenBank | ABK24242.1 | 0 | 1 | 110 | 195 | 304 | unknown [Picea sitchensis] |
EMBL | CAA07070.1 | 9.80909e-45 | 1 | 110 | 194 | 303 | beta-D-glucosidase [Tropaeolum majus] |
RefSeq | XP_001786487.1 | 7.00649e-45 | 1 | 110 | 199 | 306 | predicted protein [Physcomitrella patens subsp. patens] |
RefSeq | XP_002325849.1 | 7.9874e-44 | 1 | 110 | 178 | 287 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1x39_A | 5.99756e-43 | 1 | 110 | 170 | 279 | A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose |
PDB | 1x38_A | 5.99756e-43 | 1 | 110 | 170 | 279 | A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose |
PDB | 1lq2_A | 5.99756e-43 | 1 | 110 | 170 | 279 | A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole |
PDB | 1j8v_A | 5.99756e-43 | 1 | 110 | 170 | 279 | A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole |
PDB | 1iex_A | 5.99756e-43 | 1 | 110 | 170 | 279 | A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EX430229 | 112 | 1 | 112 | 0 |
EX354960 | 110 | 1 | 110 | 0 |
EX367322 | 110 | 1 | 110 | 0 |
DR594514 | 110 | 1 | 110 | 0 |
EX419751 | 110 | 1 | 110 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|