Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_8535581g0010 |
Family | GH35 |
Protein Properties | Length: 88 Molecular Weight: 10102.7 Isoelectric Point: 4.931 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH35 | 1 | 81 | 1.2e-32 |
WDLGGFPAWLLAEQPAVKLRSSDPAFLQLVQRWWGVLFPKIVPLLYSNGGPIIMVQVENEYGSFGDDKDYLQYLVRLARSH |
Full Sequence |
---|
Protein Sequence Length: 88 Download |
WDLGGFPAWL LAEQPAVKLR SSDPAFLQLV QRWWGVLFPK IVPLLYSNGG PIIMVQVENE 60 YGSFGDDKDY LQYLVRLARS HLRDDVIL |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN03059 | PLN03059 | 1.0e-7 | 1 | 62 | 64 | + beta-galactosidase; Provisional | ||
COG1874 | LacA | 3.0e-9 | 1 | 77 | 85 | + Beta-galactosidase [Carbohydrate transport and metabolism] | ||
pfam01301 | Glyco_hydro_35 | 3.0e-39 | 1 | 88 | 88 | + Glycosyl hydrolases family 35. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAD55646.1 | 3e-37 | 1 | 88 | 159 | 246 | AC008017_19 Similar to acid beta-galactosidase [Arabidopsis thaliana] |
GenBank | ACU17905.1 | 4e-37 | 1 | 88 | 163 | 250 | unknown [Glycine max] |
RefSeq | NP_001031273.1 | 2e-37 | 1 | 88 | 97 | 184 | BGAL17 (beta-galactosidase 17); beta-galactosidase/ catalytic/ cation binding [Arabidopsis thaliana] |
RefSeq | NP_001056172.1 | 3e-37 | 1 | 88 | 130 | 217 | Os05g0539400 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002327549.1 | 3e-38 | 1 | 88 | 105 | 192 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3thd_D | 1e-27 | 1 | 88 | 107 | 194 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 3thd_C | 1e-27 | 1 | 88 | 107 | 194 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 3thd_B | 1e-27 | 1 | 88 | 107 | 194 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 3thd_A | 1e-27 | 1 | 88 | 107 | 194 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 3thc_D | 1e-27 | 1 | 88 | 107 | 194 | A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EY159376 | 88 | 1 | 88 | 2.00386e-43 |
FC900192 | 88 | 1 | 88 | 1.99965e-42 |
FC888317 | 88 | 1 | 88 | 3.00018e-42 |
FL760736 | 88 | 1 | 88 | 3.99931e-42 |
FC891419 | 88 | 1 | 88 | 9.99967e-42 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|