| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_8561980g0010 |
| Family | GH28 |
| Protein Properties | Length: 121 Molecular Weight: 12513.1 Isoelectric Point: 6.5051 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH28 | 2 | 121 | 0 |
| GVKIKAPVDSINTDGIHLQSSNVLIRDTVVRTGDDCVSIGGGSSNIVIEGFTCGPGHGISVGSLGKGSVFEVVSNITVNGAVFNGTQNGVRIKTWEGGKG IATDLTFQNIKMKDTNNPII | |||
| Full Sequence |
|---|
| Protein Sequence Length: 121 Download |
| EGVKIKAPVD SINTDGIHLQ SSNVLIRDTV VRTGDDCVSI GGGSSNIVIE GFTCGPGHGI 60 SVGSLGKGSV FEVVSNITVN GAVFNGTQNG VRIKTWEGGK GIATDLTFQN IKMKDTNNPI 120 I 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN03003 | PLN03003 | 2.0e-34 | 3 | 121 | 120 | + Probable polygalacturonase At3g15720 | ||
| PLN02218 | PLN02218 | 9.0e-37 | 3 | 121 | 120 | + polygalacturonase ADPG | ||
| pfam00295 | Glyco_hydro_28 | 3.0e-38 | 1 | 121 | 122 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. | ||
| PLN02188 | PLN02188 | 3.0e-40 | 2 | 121 | 123 | + polygalacturonase/glycoside hydrolase family protein | ||
| PLN02793 | PLN02793 | 4.0e-46 | 2 | 121 | 121 | + Probable polygalacturonase | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAF21207.1 | 3e-37 | 3 | 121 | 231 | 350 | AC013483_31 putative polygalacturonase [Arabidopsis thaliana] |
| GenBank | ABD28401.1 | 6e-38 | 3 | 121 | 222 | 341 | Glycoside hydrolase, family 28 [Medicago truncatula] |
| EMBL | CAN83753.1 | 3e-37 | 2 | 121 | 234 | 354 | hypothetical protein [Vitis vinifera] |
| RefSeq | NP_187454.2 | 3e-37 | 3 | 121 | 232 | 351 | QRT2 (QUARTET 2); polygalacturonase [Arabidopsis thaliana] |
| RefSeq | XP_002277234.1 | 3e-37 | 2 | 121 | 234 | 354 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1bhe_A | 0.000000000002 | 5 | 121 | 192 | 309 | A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora |
| PDB | 1nhc_F | 0.000000000005 | 13 | 113 | 152 | 251 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 1nhc_E | 0.000000000005 | 13 | 113 | 152 | 251 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 1nhc_D | 0.000000000005 | 13 | 113 | 152 | 251 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 1nhc_C | 0.000000000005 | 13 | 113 | 152 | 251 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| BY906201 | 121 | 2 | 121 | 3e-38 |
| EX932295 | 120 | 3 | 121 | 3e-38 |
| ES853583 | 122 | 1 | 121 | 5e-38 |
| DR513862 | 122 | 1 | 121 | 5e-38 |
| ES873669 | 122 | 1 | 121 | 5e-38 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Picea abies | MA_219076g0010 | MA_463685g0010 | |||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |