Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_8865271g0010 |
Family | GT5 |
Protein Properties | Length: 116 Molecular Weight: 12877.8 Isoelectric Point: 4.2985 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT5 | 1 | 112 | 7.4e-38 |
MKAGILESDRAFTVSPYYAKELVSREDKGVELESIVRKVGITGIVNGMDIQEWDPSTDKYLEMNYDATTVLDAKPSLKETLQAEFGLAVDPDIPVIGFIG RLEEQKGPIFLL |
Full Sequence |
---|
Protein Sequence Length: 116 Download |
MKAGILESDR AFTVSPYYAK ELVSREDKGV ELESIVRKVG ITGIVNGMDI QEWDPSTDKY 60 LEMNYDATTV LDAKPSLKET LQAEFGLAVD PDIPVIGFIG RLEEQKGPIF LLKLSL 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PRK14099 | PRK14099 | 8.0e-24 | 1 | 112 | 114 | + glycogen synthase; Provisional | ||
COG0297 | GlgA | 1.0e-26 | 1 | 113 | 115 | + Glycogen synthase [Carbohydrate transport and metabolism] | ||
PRK00654 | glgA | 9.0e-30 | 1 | 112 | 115 | + glycogen synthase; Provisional | ||
TIGR02095 | glgA | 4.0e-38 | 1 | 113 | 115 | + glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
cd03791 | GT1_Glycogen_synthase_DULL1_like | 3.0e-39 | 1 | 112 | 114 | + This family is most closely related to the GT1 family of glycosyltransferases. Glycogen synthase catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK25128.1 | 0 | 1 | 107 | 321 | 427 | unknown [Picea sitchensis] |
GenBank | ACH91264.1 | 0 | 1 | 107 | 21 | 127 | waxy 2 [Banksia serrata] |
GenBank | ACN40142.1 | 0 | 1 | 107 | 1 | 107 | unknown [Picea sitchensis] |
GenBank | ACN40497.1 | 0 | 1 | 107 | 321 | 427 | unknown [Picea sitchensis] |
GenBank | ACN41111.1 | 0 | 1 | 107 | 321 | 427 | unknown [Picea sitchensis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3vuf_A | 8.00141e-43 | 1 | 108 | 235 | 342 | A Chain A, Human Stard13 (Dlc2) Lipid Transfer And Protein Localization Domain |
PDB | 3vue_A | 8.00141e-43 | 1 | 108 | 235 | 342 | A Chain A, Crystal Structure Of Rice Granule Bound Starch Synthase I Catalytic Domain |
PDB | 3cx4_A | 0.000000000001 | 1 | 107 | 198 | 306 | A Chain A, Crystal Structure Of Rice Granule Bound Starch Synthase I Catalytic Domain |
PDB | 3cop_A | 0.000000000001 | 1 | 107 | 198 | 306 | A Chain A, Crystal Structure Of E.Coli Gs Mutant E377a In Complex With Adp And Acceptor Analogue Heppso |
PDB | 3guh_A | 0.000000000001 | 1 | 107 | 198 | 306 | A Chain A, Crystal Structure Of E.Coli Gs Mutant E377a In Complex With Adp And Acceptor Analogue Heppso |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GT052007 | 108 | 1 | 108 | 0 |
DV971866 | 111 | 1 | 111 | 0 |
DR552052 | 108 | 1 | 108 | 0 |
DV984155 | 108 | 1 | 108 | 0 |
GT738849 | 108 | 1 | 108 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|