Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_90526g0020 |
Family | CBM43 |
Protein Properties | Length: 87 Molecular Weight: 9282.21 Isoelectric Point: 4.6646 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 2 | 71 | 2e-30 |
SALQEALNYACGAGADCSAIQARNACYQPNTVEAHASYAFNSYWQSTKSSGGTCNFNGVASLTTSDPSES |
Full Sequence |
---|
Protein Sequence Length: 87 Download |
MSALQEALNY ACGAGADCSA IQARNACYQP NTVEAHASYA FNSYWQSTKS SGGTCNFNGV 60 ASLTTSDPSE SYNFSPLISC FRLMSPF |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-16 | 2 | 62 | 66 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 4.0e-29 | 1 | 71 | 71 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | EEC77981.1 | 2e-26 | 4 | 70 | 1 | 67 | hypothetical protein OsI_17358 [Oryza sativa Indica Group] |
RefSeq | XP_002312230.1 | 1e-25 | 4 | 71 | 227 | 294 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002315076.1 | 4e-25 | 4 | 70 | 13 | 79 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002516415.1 | 8e-25 | 4 | 69 | 189 | 254 | conserved hypothetical protein [Ricinus communis] |
RefSeq | XP_002520569.1 | 6e-26 | 2 | 69 | 173 | 240 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.00000000000005 | 4 | 69 | 25 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DR549581 | 69 | 1 | 69 | 9e-39 |
DR467077 | 69 | 1 | 69 | 6e-38 |
DR549205 | 69 | 1 | 69 | 9e-38 |
CO241859 | 69 | 1 | 69 | 9e-38 |
DR553212 | 66 | 4 | 69 | 2e-37 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|