Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_907g0010 |
Family | CBM43 |
Protein Properties | Length: 109 Molecular Weight: 12421.1 Isoelectric Point: 5.762 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 30 | 108 | 7.9e-22 |
WCGVDANANISALPSTIIFSCSQGDNTCITIQPWEPCYQPNEVIDHASYAFNSYWRQFKNYYVDCDLNKSGTLVTKDPS |
Full Sequence |
---|
Protein Sequence Length: 109 Download |
MYEINLTGKL QDSQYKFLPP LPPPYKAKLW CGVDANANIS ALPSTIIFSC SQGDNTCITI 60 QPWEPCYQPN EVIDHASYAF NSYWRQFKNY YVDCDLNKSG TLVTKDPSK |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 1.0e-6 | 29 | 101 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 1.0e-19 | 29 | 108 | 80 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAA89481.1 | 2e-23 | 1 | 108 | 357 | 467 | beta-1,3-glucanase [Salix gilgiana] |
EMBL | CAK18899.1 | 5e-25 | 1 | 108 | 19 | 131 | glucan 1,3-beta glucosidase [Cocos nucifera] |
EMBL | CBI39470.1 | 9e-23 | 1 | 108 | 347 | 456 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002303070.1 | 6e-23 | 1 | 108 | 340 | 450 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002534357.1 | 1e-23 | 1 | 108 | 266 | 376 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.00000000004 | 20 | 108 | 3 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CO481041 | 108 | 1 | 108 | 0 |
CO255812 | 108 | 1 | 108 | 0 |
ES248854 | 108 | 1 | 108 | 0 |
CO481300 | 108 | 1 | 108 | 0 |
CO242447 | 108 | 1 | 108 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|