| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_9120023g0010 |
| Family | CE8 |
| Protein Properties | Length: 93 Molecular Weight: 10624.1 Isoelectric Point: 8.4761 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 1 | 84 | 2.7e-30 |
| DFIFGNSAVVLQNCNLLARRPLENQKILYTAQRRQDPNENTGISIQNCNVTAAPDLLSVKSSFEVYLGRPWKEYSRTVFMQSFA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 93 Download |
| DFIFGNSAVV LQNCNLLARR PLENQKILYT AQRRQDPNEN TGISIQNCNV TAAPDLLSVK 60 SSFEVYLGRP WKEYSRTVFM QSFAGLLYCT MEK |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02484 | PLN02484 | 3.0e-39 | 1 | 85 | 85 | + probable pectinesterase/pectinesterase inhibitor | ||
| PLN03043 | PLN03043 | 2.0e-39 | 1 | 87 | 87 | + Probable pectinesterase/pectinesterase inhibitor; Provisional | ||
| PLN02713 | PLN02713 | 2.0e-40 | 1 | 85 | 85 | + Probable pectinesterase/pectinesterase inhibitor | ||
| PLN02301 | PLN02301 | 1.0e-42 | 1 | 85 | 85 | + pectinesterase/pectinesterase inhibitor | ||
| pfam01095 | Pectinesterase | 8.0e-52 | 1 | 83 | 83 | + Pectinesterase. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABQ42392.1 | 2e-40 | 1 | 83 | 432 | 514 | pectin methylesterase-like protein [Taiwania cryptomerioides] |
| GenBank | ACN40984.1 | 3e-40 | 1 | 87 | 438 | 524 | unknown [Picea sitchensis] |
| DDBJ | BAF95866.1 | 3e-39 | 1 | 87 | 37 | 123 | pectin methylesterase isoform alpha [Vitis hybrid cultivar] |
| GenBank | EEE54425.1 | 8e-38 | 1 | 82 | 422 | 503 | hypothetical protein OsJ_01485 [Oryza sativa Japonica Group] |
| RefSeq | NP_001042866.1 | 1e-37 | 1 | 82 | 264 | 345 | Os01g0312500 [Oryza sativa (japonica cultivar-group)] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 2e-31 | 1 | 82 | 157 | 238 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 2e-30 | 1 | 87 | 153 | 239 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 1qjv_B | 0.005 | 1 | 71 | 175 | 245 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
| PDB | 1qjv_A | 0.005 | 1 | 71 | 175 | 245 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
| PDB | 2ntq_B | 0.005 | 1 | 71 | 175 | 245 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
| Hydropathy |
|---|
 |
