| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_9188108g0010 |
| Family | GT1 |
| Protein Properties | Length: 137 Molecular Weight: 15198.3 Isoelectric Point: 5.5547 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT1 | 24 | 137 | 6.7e-21 |
| GEILEWLDRQTRGSVVYVSFGTQSHISPAQVMELAMGLEASGQPFLWVLRPPDSRLTVGSSSAEDWKAELLPEGYERRVKGRCLIETGWAPQGAILAHEA TGAFISHCGWNSCL | |||
| Full Sequence |
|---|
| Protein Sequence Length: 137 Download |
| MFWAVGPVID LPDRDHKLHS PREGEILEWL DRQTRGSVVY VSFGTQSHIS PAQVMELAMG 60 LEASGQPFLW VLRPPDSRLT VGSSSAEDWK AELLPEGYER RVKGRCLIET GWAPQGAILA 120 HEATGAFISH CGWNSCL |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN03015 | PLN03015 | 7.0e-32 | 3 | 137 | 135 | + UDP-glucosyl transferase | ||
| PLN02670 | PLN02670 | 8.0e-35 | 7 | 135 | 130 | + transferase, transferring glycosyl groups | ||
| PLN02534 | PLN02534 | 7.0e-36 | 3 | 135 | 140 | + UDP-glycosyltransferase | ||
| PLN00164 | PLN00164 | 3.0e-36 | 3 | 137 | 136 | + glucosyltransferase; Provisional | ||
| PLN03007 | PLN03007 | 7.0e-37 | 3 | 137 | 142 | + UDP-glucosyltransferase family protein | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABR18159.1 | 0 | 1 | 137 | 249 | 385 | unknown [Picea sitchensis] |
| EMBL | CAN81633.1 | 1e-33 | 3 | 137 | 248 | 392 | hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002268786.1 | 1e-34 | 3 | 137 | 247 | 378 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002333409.1 | 5e-35 | 3 | 137 | 103 | 232 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002333410.1 | 2e-33 | 27 | 137 | 1 | 108 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2vg8_A | 3e-28 | 3 | 137 | 237 | 371 | A Chain A, Structural Insights Into Substrate Specificity And The Anti Beta-Elimination Mechanism Of Pectate Lyase |
| PDB | 2vch_A | 3e-28 | 3 | 137 | 237 | 371 | A Chain A, Structural Insights Into Substrate Specificity And The Anti Beta-Elimination Mechanism Of Pectate Lyase |
| PDB | 2vce_A | 3e-28 | 3 | 137 | 237 | 371 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2acw_B | 9e-25 | 3 | 137 | 242 | 364 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
| PDB | 2acw_A | 9e-25 | 3 | 137 | 242 | 364 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DR492275 | 134 | 4 | 137 | 0 |
| DR543449 | 125 | 13 | 137 | 0 |
| DV971612 | 136 | 3 | 137 | 0 |
| CF385056 | 138 | 2 | 137 | 0 |
| CF386347 | 138 | 2 | 137 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
