Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_962758g0010 |
Family | CBM43 |
Protein Properties | Length: 112 Molecular Weight: 11702 Isoelectric Point: 3.0487 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 24 | 107 | 5e-34 |
WCVASPAANQLDLQEALDWACGPGLADCSGIQPGQPCYQPSNLLSVASYAFNMYYQSNGNSPVACNFGGTGMITSSDPSYGICQ |
Full Sequence |
---|
Protein Sequence Length: 112 Download |
MPNTPITTFS PPEGNTTFID GTTWCVASPA ANQLDLQEAL DWACGPGLAD CSGIQPGQPC 60 YQPSNLLSVA SYAFNMYYQS NGNSPVACNF GGTGMITSSD PSYGICQFLT SG 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 8.0e-22 | 23 | 95 | 82 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-38 | 23 | 108 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK26650.1 | 0 | 1 | 112 | 1 | 112 | unknown [Picea sitchensis] |
EMBL | CBI30973.1 | 0 | 5 | 112 | 583 | 690 | unnamed protein product [Vitis vinifera] |
GenBank | EAZ02781.1 | 0 | 4 | 111 | 36 | 143 | hypothetical protein OsI_24906 [Oryza sativa Indica Group] |
RefSeq | NP_001144702.1 | 0 | 4 | 111 | 38 | 145 | hypothetical protein LOC100277738 [Zea mays] |
RefSeq | XP_002461458.1 | 0 | 4 | 109 | 37 | 142 | hypothetical protein SORBIDRAFT_02g002990 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 2e-16 | 23 | 108 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DR537771 | 112 | 1 | 112 | 0 |
DR684971 | 109 | 1 | 109 | 0 |
DT632656 | 106 | 1 | 106 | 0 |
DR519743 | 91 | 22 | 112 | 0 |
DN209750 | 106 | 4 | 109 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|