Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_9682123g0010 |
Family | GH19 |
Protein Properties | Length: 143 Molecular Weight: 15696.4 Isoelectric Point: 4.6844 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 28 | 139 | 2.29813e-43 |
VSDIATQDFFNGILSAATDGCAGKTFYTYTDFINAANSFSSFGTTGTSDDNKREIAAFFANVAHETSNLCYVEEIAKSDYCDSSNTQYPCASGQQYYGRG PLQLTGYVYRFI |
Full Sequence |
---|
Protein Sequence Length: 143 Download |
MATHFRVNVI FLWLAFALSA LSICRGAVSD IATQDFFNGI LSAATDGCAG KTFYTYTDFI 60 NAANSFSSFG TTGTSDDNKR EIAAFFANVA HETSNLCYVE EIAKSDYCDS SNTQYPCASG 120 QQYYGRGPLQ LTGYVYRFIS QQL |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00182 | Glyco_hydro_19 | 7.0e-32 | 31 | 132 | 117 | + Chitinase class I. | ||
cd00325 | chitinase_glyco_hydro_19 | 2.0e-33 | 33 | 132 | 113 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK21702.1 | 0 | 1 | 133 | 1 | 133 | unknown [Picea sitchensis] |
GenBank | ABK21750.1 | 0 | 1 | 133 | 1 | 132 | unknown [Picea sitchensis] |
GenBank | ABK22545.1 | 0 | 1 | 133 | 1 | 133 | unknown [Picea sitchensis] |
GenBank | ABK23908.1 | 0 | 1 | 133 | 1 | 133 | unknown [Picea sitchensis] |
GenBank | ACN39919.1 | 0 | 1 | 133 | 1 | 133 | unknown [Picea sitchensis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3hbh_A | 2e-35 | 27 | 132 | 1 | 106 | A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558. |
PDB | 3hbe_X | 2e-35 | 27 | 132 | 1 | 106 | A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558. |
PDB | 3hbd_A | 2e-35 | 27 | 132 | 1 | 106 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
PDB | 2z38_A | 9e-24 | 26 | 132 | 3 | 124 | A Chain A, Crystal Structure Of Chloride Bound Brassica Juncea Chitinase Catalytic Module (Bjchi3) |
PDB | 2z37_D | 3e-23 | 28 | 132 | 2 | 121 | A Chain A, Crystal Structure Of Brassica Juncea Chitinase Catalytic Module (Bjchi3) |