Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_9796357g0010 |
Family | CBM43 |
Protein Properties | Length: 114 Molecular Weight: 12633.4 Isoelectric Point: 4.6641 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 76 | 9.3e-28 |
GADPKLLQAALDWACGPRKFDCTALLQVQSCYDPDNVQQNASYAFDSYYHETGMAAGACDFNGVATITTTDPSK |
Full Sequence |
---|
Protein Sequence Length: 114 Download |
MDGADPKLLQ AALDWACGPR KFDCTALLQV QSCYDPDNVQ QNASYAFDSY YHETGMAAGA 60 CDFNGVATIT TTDPSKLHFP PLENLLQNLV LLCRETCGVK SASRMLFFTY FLLH 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 1.0e-14 | 2 | 68 | 72 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-28 | 1 | 75 | 75 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAG51762.1 | 7e-31 | 2 | 82 | 331 | 411 | AC066691_2 beta-1,3-glucanase precursor, putative; 34016-35272 [Arabidopsis thaliana] |
EMBL | CAN82488.1 | 7e-30 | 2 | 75 | 332 | 405 | hypothetical protein [Vitis vinifera] |
EMBL | CBI26850.1 | 9e-30 | 2 | 75 | 365 | 438 | unnamed protein product [Vitis vinifera] |
EMBL | CBI33479.1 | 8e-30 | 2 | 75 | 364 | 437 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002531922.1 | 3e-33 | 2 | 75 | 376 | 449 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.0000002 | 9 | 84 | 25 | 101 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CO479005 | 114 | 1 | 114 | 0 |
DR571559 | 75 | 1 | 75 | 1.99965e-42 |
DR559392 | 75 | 1 | 75 | 3.99931e-42 |
DR564378 | 75 | 1 | 75 | 3.99931e-42 |
CO478960 | 75 | 1 | 75 | 9.00054e-42 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|