| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_9819944g0010 |
| Family | CE8 |
| Protein Properties | Length: 124 Molecular Weight: 13234 Isoelectric Point: 10.0387 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 11 | 124 | 1.30321e-43 |
| AVVAKDGSGNYTNITEAVEAAPEKSKTRYVIHIKAGVYAENVELHKKKTNLMFLGDGMDVTVVTGNRNVKENFTTFRSATVAVTGKGFIARDMTFENTAG AAKHQAVALRVGSD | |||
| Full Sequence |
|---|
| Protein Sequence Length: 124 Download |
| QTSTGTVKPN AVVAKDGSGN YTNITEAVEA APEKSKTRYV IHIKAGVYAE NVELHKKKTN 60 LMFLGDGMDV TVVTGNRNVK ENFTTFRSAT VAVTGKGFIA RDMTFENTAG AAKHQAVALR 120 VGSD |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02314 | PLN02314 | 9.0e-48 | 8 | 124 | 117 | + pectinesterase | ||
| PLN02506 | PLN02506 | 2.0e-51 | 3 | 124 | 122 | + putative pectinesterase/pectinesterase inhibitor | ||
| PLN02301 | PLN02301 | 1.0e-54 | 1 | 124 | 124 | + pectinesterase/pectinesterase inhibitor | ||
| PLN02201 | PLN02201 | 5.0e-56 | 4 | 124 | 121 | + probable pectinesterase/pectinesterase inhibitor | ||
| pfam01095 | Pectinesterase | 9.0e-67 | 10 | 124 | 115 | + Pectinesterase. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1GQ8 | 0 | 4 | 124 | 2 | 122 | A Chain A, Pectin Methylesterase From Carrot |
| GenBank | ABG46324.1 | 0 | 1 | 124 | 236 | 359 | putative pectin methylesterase [Picea abies] |
| GenBank | ABZ89800.1 | 0 | 1 | 124 | 263 | 386 | pectin methylesterase-like protein [Taiwania cryptomerioides] |
| GenBank | ACN40984.1 | 0 | 1 | 124 | 280 | 403 | unknown [Picea sitchensis] |
| Swiss-Prot | P83218 | 0 | 4 | 124 | 2 | 122 | PME_DAUCA RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin methylesterase |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 0 | 4 | 124 | 2 | 122 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 5.00264e-43 | 10 | 124 | 4 | 118 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 3uw0_A | 0.00002 | 10 | 107 | 32 | 133 | A Chain A, Pectin Methylesterase From Yersinia Enterocolitica |
| PDB | 2nt9_B | 0.01 | 10 | 116 | 5 | 116 | A Chain A, Pectin Methylesterase From Yersinia Enterocolitica |
| PDB | 2nt9_A | 0.01 | 10 | 116 | 5 | 116 | A Chain A, Pectin Methylesterase From Yersinia Enterocolitica |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DV972440 | 121 | 1 | 121 | 0 |
| BQ702503 | 124 | 1 | 124 | 0 |
| GT739726 | 121 | 4 | 124 | 0 |
| DR386802 | 124 | 1 | 124 | 0 |
| FE523419 | 124 | 1 | 124 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |