Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_9930140g0010 |
Family | AA2 |
Protein Properties | Length: 212 Molecular Weight: 23277.1 Isoelectric Point: 8.8331 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 14 | 184 | 6e-28 |
TGGPTWVVELGRRDGLISSNSDAASHLPSAQSNAQALIDNFSSNGLSIRDLVTLSGAHTYGKTHCPPIARRLYQFSNNSGIDPTLNKTYAMGLMKKCTLP INPNATVPLDPSTPNTFDNAYFKELMQNEGIFSSDSALVIDARTRVFVTEYANDENSFRDQFGDAMIRMGR |
Full Sequence |
---|
Protein Sequence Length: 212 Download |
MFSLNFTNLK GNRTGGPTWV VELGRRDGLI SSNSDAASHL PSAQSNAQAL IDNFSSNGLS 60 IRDLVTLSGA HTYGKTHCPP IARRLYQFSN NSGIDPTLNK TYAMGLMKKC TLPINPNATV 120 PLDPSTPNTF DNAYFKELMQ NEGIFSSDSA LVIDARTRVF VTEYANDENS FRDQFGDAMI 180 RMGRIQILTG QQGEIRKRCG FVNSNSTRQA AN |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00141 | peroxidase | 0.001 | 136 | 167 | 32 | + Peroxidase. | ||
pfam00141 | peroxidase | 4.0e-18 | 14 | 72 | 59 | + Peroxidase. | ||
cd00691 | ascorbate_peroxidase | 4.0e-19 | 14 | 182 | 179 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
PLN03030 | PLN03030 | 1.0e-35 | 14 | 203 | 195 | + cationic peroxidase; Provisional | ||
cd00693 | secretory_peroxidase | 4.0e-89 | 14 | 202 | 189 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACN60160.1 | 0 | 14 | 204 | 136 | 328 | peroxidase [Tamarix hispida] |
EMBL | CAN64129.1 | 0 | 4 | 203 | 180 | 379 | hypothetical protein [Vitis vinifera] |
RefSeq | NP_194746.1 | 0 | 14 | 203 | 136 | 325 | peroxidase, putative [Arabidopsis thaliana] |
RefSeq | XP_001751508.1 | 0 | 15 | 203 | 154 | 342 | predicted protein [Physcomitrella patens subsp. patens] |
RefSeq | XP_001783974.1 | 0 | 13 | 203 | 124 | 314 | predicted protein [Physcomitrella patens subsp. patens] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3hdl_A | 8.96831e-44 | 10 | 204 | 108 | 304 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
PDB | 1gx2_B | 4e-39 | 15 | 206 | 114 | 309 | A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid |
PDB | 1gx2_A | 4e-39 | 15 | 206 | 114 | 309 | A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid |
PDB | 3atj_B | 5e-39 | 15 | 206 | 114 | 309 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
PDB | 3atj_A | 5e-39 | 15 | 206 | 114 | 309 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DR579138 | 200 | 13 | 212 | 0 |
CO239331 | 200 | 13 | 212 | 0 |
DR572547 | 200 | 13 | 212 | 0 |
ES859012 | 195 | 18 | 212 | 0 |
CO165064 | 200 | 13 | 212 | 0 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Picea abies | MA_591890g0010 | MA_10430442g0010 | |||
Vitis vinifera | GSVIVT01017829001 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|