Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_9952704g0010 |
Family | GH19 |
Protein Properties | Length: 115 Molecular Weight: 12449 Isoelectric Point: 5.6208 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 37 | 105 | 2.9e-29 |
VASIISEDFFNQFLKHRNDDACPTKGFYTYNAFIVAANSFPDFGNNGDLETSKRELAAFFGQTSQETTG |
Full Sequence |
---|
Protein Sequence Length: 115 Download |
MASTTIGRMK SMRVLSTLTA LAMMGTLCCH VSAQQGVASI ISEDFFNQFL KHRNDDACPT 60 KGFYTYNAFI VAANSFPDFG NNGDLETSKR ELAAFFGQTS QETTGGWATA PDGPY 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00325 | chitinase_glyco_hydro_19 | 5.0e-40 | 41 | 115 | 75 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. | ||
pfam00182 | Glyco_hydro_19 | 5.0e-43 | 40 | 115 | 76 | + Chitinase class I. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAC49718.1 | 0 | 1 | 115 | 1 | 115 | Pschi4 [Pinus strobus] |
GenBank | AAS15707.1 | 0 | 1 | 115 | 1 | 115 | putative class II chitinase [Picea abies] |
GenBank | AAT09427.1 | 0 | 1 | 115 | 1 | 115 | class II chitinase [Picea abies] |
GenBank | ABK25320.1 | 0 | 1 | 115 | 1 | 115 | unknown [Picea sitchensis] |
GenBank | ACN40115.1 | 0 | 1 | 115 | 1 | 115 | unknown [Picea sitchensis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3cql_B | 5e-33 | 36 | 115 | 1 | 80 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 3cql_A | 5e-33 | 36 | 115 | 1 | 80 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 3w3e_B | 7e-29 | 37 | 115 | 3 | 81 | A Chain A, Structure Of Vigna Unguiculata Chitinase With Regulation Activity Of The Plant Cell Wall |
PDB | 3w3e_A | 7e-29 | 37 | 115 | 3 | 81 | A Chain A, Structure Of Vigna Unguiculata Chitinase With Regulation Activity Of The Plant Cell Wall |
PDB | 4dyg_B | 1e-27 | 37 | 115 | 3 | 81 | A Chain A, Structure Of Vigna Unguiculata Chitinase With Regulation Activity Of The Plant Cell Wall |