y PlantCAZyme

CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000128213
FamilyCE8
Protein PropertiesLength: 311 Molecular Weight: 34521.8 Isoelectric Point: 8.6524
ChromosomeChromosome/Scaffold: 014010332 Start: 11517 End: 12452
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82243089e-28
  MIVAQDGSGNYKSISEAVNSAHKLRSGATKRFVIHVKAGVYRENVEIKKTMKNIMFIGDGIDATIVTGNKNSQDGSTTYRSATLV
Full Sequence
Protein Sequence     Length: 311     Download
MEFNAYFLVF YSLLFMLQHS SCRITAPCSQ TPHPQVCHHY INTNLLSTLD YQQRFSFRDL    60
VLKATMEQAI KAHQLVSSLN LNSLDGDDER AKLACNDCLE LYEDTVDKLN RSIGSSNXFD    120
ANTWLSASLA NLKTCQNGFV DFNISSSHLQ SFPNYVTLSS NLSKMLSNSL SVHKVSTFPS    180
ALHFSKQVRG RRRTLLSDDG FPEWVSAADR RLLQSGSSGP KADMIVAQDG SGNYKSISEA    240
VNSAHKLRSG ATKRFVIHVK AGVYRENVEI KKTMKNIMFI GDGIDATIVT GNKNSQDGST    300
TYRSATLVCL S                                                         360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02506PLN025062.0e-4062307257+
PLN02314PLN023148.0e-4224308299+
PLN02995PLN029956.0e-428306314+
PLN02468PLN024682.0e-4221306294+
PLN02301PLN023013.0e-4462307254+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN77092.1033079277hypothetical protein [Vitis vinifera]
EMBLCBI24286.101931019286unnamed protein product [Vitis vinifera]
RefSeqNP_173733.101730727333pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002314796.10330711301predicted protein [Populus trichocarpa]
RefSeqXP_002527782.1033079299Pectinesterase-1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A3e-24214311193A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A9e-20222311389B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EB146664234102430
EB15094918221830
EB15095620112010
CV882049194902830
CV6286301791293070
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00168.3Aquca_020_00601.2.274.356Aquca_020_00601.2.274.356Aquca_020_00601.4
Citrus sinensisorange1.1g017225morange1.1g018173m
Eucalyptus grandisEucgr.E01465.1
Fragaria vescamrna03925.1-v1.0-hybridmrna03928.1-v1.0-hybrid
Malus domesticaMDP0000146296MDP0000460020MDP0000206593MDP0000163228MDP0000712623
MDP0000517601.19.102MDP0000672480MDP0000222620MDP0000162904.274.358MDP0000162904.274.358
MDP0000517601.19.102
Medicago truncatulaMedtr8g104580.1.221.312Medtr8g104580.1.221.312Medtr8g104630.1Medtr8g023310.2
Oryza sativaLOC_Os01g21034.2LOC_Os01g21034.3
Panicum virgatumPavirv00054581mPavirv00058605m
Physcomitrella patensPp1s29_318V6.1.198.287Pp1s29_318V6.1.198.287
Picea abiesMA_2409806g0010MA_7418191g0010
Populus trichocarpaPotri.002G202500.3
Prunus persicappa020079m
Ricinus communis29739.m003671.273.36129739.m003671.273.361
Setaria italicaSi004722m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny