y PlantCAZyme

CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000128558
FamilyGH1
Protein PropertiesLength: 289 Molecular Weight: 33446.3 Isoelectric Point: 8.1658
ChromosomeChromosome/Scaffold: 015318233 Start: 3120 End: 5530
DescriptionB-S glucosidase 44
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH111980
  IEPFVTMYHFDLPQVLQEKYGGLMHQMFVKDFSDYAELCFKLFGDRVRHWFTINEPNVIAQYGYELGIAPPGRCSLPQGHCALGSPPRCMVPRAPVTLVV
  EQNGEIGIVLATKYFKPYSKSQEDRAAAKRLFDFYLGWLMGPLVFGKYPQSMRELVKERLPTFSAEEKSLVKGNLGFAGIKYYVSVHAKYRPPPPTEN
Full Sequence
Protein Sequence     Length: 289     Download
IEPFVTMYHF DLPQVLQEKY GGLMHQMFVK DFSDYAELCF KLFGDRVRHW FTINEPNVIA    60
QYGYELGIAP PGRCSLPQGH CALGSPPRCM VPRAPVTLVV EQNGEIGIVL ATKYFKPYSK    120
SQEDRAAAKR LFDFYLGWLM GPLVFGKYPQ SMRELVKERL PTFSAEEKSL VKGNLGFAGI    180
KYYVSVHAKY RPPPPTENLR YSYDPWAEEK DIKVVPGVSG NHWPEGLQKL MKNGANVEGY    240
FCWALFDYFE WGIGLLQQFG LYYVDFEDNS KRYPKQSAKW FRDFNNNNY                300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02814PLN028142.0e-531286360+
TIGR03356BGL2.0e-561281333+
PLN02998PLN029981.0e-601284351+
PLN02849PLN028495.0e-621284347+
pfam00232Glyco_hydro_11.0e-741288350+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI33559.10128290443unnamed protein product [Vitis vinifera]
RefSeqXP_002272413.101282156509PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002277198.101284145503PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002277243.10128448406PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002448027.101284151509hypothetical protein SORBIDRAFT_06g019840 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B01284144502A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum
PDB3ptq_A01284144502A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum
PDB3ptm_B01284144502A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum
PDB3ptm_A01284144502A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum
PDB3ptk_B01284144502A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO77773935712850
HO79496335712850
CO11359325112290
FG22781535512840
EL41162222112040
Orthologous Group
SpeciesID
Malus domesticaMDP0000318790MDP0000199627MDP0000911142
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny