| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000128678 |
| Family | GT1 |
| Protein Properties | Length: 146 Molecular Weight: 16276.9 Isoelectric Point: 7.1796 |
| Chromosome | Chromosome/Scaffold: 01553026 Start: 1929 End: 2369 |
| Description | UDP-Glycosyltransferase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT1 | 12 | 119 | 2.7e-28 |
| RGLMVPWCSQIEVLLHPAIGGFLTHCGWNSILESMRCGVPMLCFPLWTDQITNRKLVVDDWGIGLNLCDTVKLVTRGEVGEKINRLMCGDSGDGLQKQIK KVRQTLED | |||
| Full Sequence |
|---|
| Protein Sequence Length: 146 Download |
| MPVGFEDETK DRGLMVPWCS QIEVLLHPAI GGFLTHCGWN SILESMRCGV PMLCFPLWTD 60 QITNRKLVVD DWGIGLNLCD TVKLVTRGEV GEKINRLMCG DSGDGLQKQI KKVRQTLEDA 120 LAVNGSSERN LSQFICGVKE KIRTRA |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02554 | PLN02554 | 2.0e-30 | 1 | 142 | 151 | + UDP-glycosyltransferase family protein | ||
| PLN02152 | PLN02152 | 1.0e-30 | 4 | 135 | 133 | + indole-3-acetate beta-glucosyltransferase | ||
| PLN02992 | PLN02992 | 3.0e-35 | 1 | 125 | 126 | + coniferyl-alcohol glucosyltransferase | ||
| PLN02555 | PLN02555 | 5.0e-38 | 1 | 145 | 148 | + limonoid glucosyltransferase | ||
| PLN02448 | PLN02448 | 3.0e-44 | 11 | 135 | 130 | + UDP-glycosyltransferase family protein | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAG80548.1 | 0 | 1 | 138 | 332 | 468 | UDP-glucose:glucosyltransferase [Lycium barbarum] |
| RefSeq | NP_181234.1 | 0 | 1 | 145 | 334 | 477 | UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana] |
| RefSeq | XP_002276858.1 | 0 | 1 | 145 | 332 | 475 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002314296.1 | 0 | 1 | 145 | 331 | 474 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002523692.1 | 0 | 1 | 146 | 333 | 477 | UDP-glucosyltransferase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2pq6_A | 3e-30 | 5 | 138 | 347 | 477 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2vg8_A | 2e-26 | 1 | 132 | 328 | 461 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2vch_A | 2e-26 | 1 | 132 | 328 | 461 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2vce_A | 2e-26 | 1 | 132 | 328 | 461 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2c9z_A | 2e-25 | 1 | 131 | 315 | 443 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EG631249 | 146 | 1 | 146 | 0 |
| GO533525 | 129 | 1 | 129 | 0 |
| DR993677 | 112 | 1 | 112 | 0 |
| FG637067 | 146 | 1 | 146 | 0 |
| FG200527 | 146 | 1 | 146 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
