Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000132451 |
Family | CBM43 |
Protein Properties | Length: 81 Molecular Weight: 9113.22 Isoelectric Point: 5.7325 |
Chromosome | Chromosome/Scaffold: 02186268 Start: 386 End: 631 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 9 | 69 | 1.8e-22 |
WCITDELTLDDKWQAAMDWACGGGGGADCSQIQVKQACYFPNTLKDHASYAFNNYFQRFKY |
Full Sequence |
---|
Protein Sequence Length: 81 Download |
FSAAKFEQWC ITDELTLDDK WQAAMDWACG GGGGADCSQI QVKQACYFPN TLKDHASYAF 60 NNYFQRFKYK GGDLATSRVL L |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 1.0e-7 | 8 | 72 | 70 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 7.0e-18 | 8 | 73 | 66 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK92842.1 | 2e-28 | 2 | 72 | 24 | 93 | unknown [Populus trichocarpa] |
EMBL | CAN67352.1 | 4e-29 | 2 | 72 | 22 | 91 | hypothetical protein [Vitis vinifera] |
EMBL | CBI28425.1 | 1e-29 | 2 | 72 | 22 | 91 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002269977.1 | 8e-30 | 2 | 72 | 1239 | 1308 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002321180.1 | 8e-30 | 2 | 72 | 22 | 91 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.000000008 | 9 | 66 | 13 | 68 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BU865878 | 77 | 2 | 78 | 4e-27 |
DT035040 | 71 | 2 | 72 | 1e-26 |
HO092972 | 71 | 2 | 72 | 1e-26 |
EE090966 | 71 | 2 | 72 | 2e-26 |
CB918545 | 71 | 2 | 72 | 3e-26 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|