y
Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000134605 |
Family | CBM43 |
Protein Properties | Length: 99 Molecular Weight: 10802.1 Isoelectric Point: 7.2419 |
Chromosome | Chromosome/Scaffold: 002827319 Start: 88 End: 451 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 8 | 85 | 5.5e-31 |
WCVVKLTVPDPIIQEAXDYACGSGADCKFIRPNGSCYQPDTLLSHASYAFNSYWQNTKIAGGTCDFGGIAMLVTVDPK |
Full Sequence |
---|
Protein Sequence Length: 99 Download |
KLPQFAVWCV VKLTVPDPII QEAXDYACGS GADCKFIRPN GSCYQPDTLL SHASYAFNSY 60 WQNTKIAGGT CDFGGIAMLV TVDPKLSFKD TLFHSRTSG 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 6.0e-21 | 8 | 78 | 80 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 5.0e-34 | 8 | 84 | 77 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN78496.1 | 1.99965e-42 | 1 | 86 | 169 | 254 | hypothetical protein [Vitis vinifera] |
EMBL | CBI34142.1 | 1.99965e-42 | 1 | 86 | 160 | 245 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002264622.1 | 3e-40 | 1 | 84 | 169 | 252 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002312230.1 | 1e-39 | 3 | 92 | 210 | 299 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002520569.1 | 1.99993e-41 | 4 | 86 | 159 | 241 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.00000000000003 | 8 | 85 | 13 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CO982195 | 84 | 1 | 84 | 1.4013e-45 |
FG856541 | 84 | 1 | 84 | 9.80909e-45 |
CF373123 | 93 | 1 | 93 | 3.00018e-42 |
EG665507 | 81 | 4 | 84 | 9.99967e-42 |
EG679312 | 89 | 4 | 92 | 1.99993e-41 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|