| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000135450 |
| Family | CE8 |
| Protein Properties | Length: 97 Molecular Weight: 11002.6 Isoelectric Point: 7.2823 |
| Chromosome | Chromosome/Scaffold: 002208195 Start: 2283 End: 3302 |
| Description | pectin methylesterase 31 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CE8 | 9 | 77 | 3.6e-32 |
| SCQAVAIRVTTDQCAFYNCKFLGWQDTLYLHYGKQYLKDCYVEGSVDFIFCNSTALLEHCHIHCKSAGF | |||
| Full Sequence |
|---|
| Protein Sequence Length: 97 Download |
| MSGWSSRGSC QAVAIRVTTD QCAFYNCKFL GWQDTLYLHY GKQYLKDCYV EGSVDFIFCN 60 STALLEHCHI HCKSAGFIYN CPKQEIFPGD NGICILK 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02432 | PLN02432 | 5.0e-21 | 9 | 76 | 68 | + putative pectinesterase | ||
| PLN02665 | PLN02665 | 2.0e-21 | 11 | 78 | 68 | + pectinesterase family protein | ||
| pfam01095 | Pectinesterase | 6.0e-25 | 11 | 73 | 63 | + Pectinesterase. | ||
| PLN02682 | PLN02682 | 8.0e-28 | 11 | 71 | 61 | + pectinesterase family protein | ||
| PLN02773 | PLN02773 | 4.0e-48 | 5 | 78 | 74 | + pectinesterase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | EAY78435.1 | 2e-38 | 5 | 78 | 134 | 207 | hypothetical protein OsI_33526 [Oryza sativa Indica Group] |
| RefSeq | NP_001064567.1 | 2e-38 | 5 | 78 | 134 | 207 | Os10g0407000 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_002283941.1 | 6e-40 | 5 | 78 | 114 | 187 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002305315.1 | 8.99999e-40 | 5 | 78 | 114 | 187 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002530008.1 | 9.99995e-41 | 5 | 78 | 114 | 187 | Pectinesterase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 3e-18 | 11 | 76 | 113 | 178 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 0.0000000000006 | 11 | 76 | 109 | 174 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntq_B | 0.00000000004 | 11 | 70 | 129 | 190 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntq_A | 0.00000000004 | 11 | 70 | 129 | 190 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntp_B | 0.00000000004 | 11 | 70 | 129 | 190 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| GR905100 | 91 | 5 | 95 | 9.99967e-42 |
| FS958212 | 74 | 5 | 78 | 9.99967e-42 |
| CN912775 | 74 | 5 | 78 | 1.99993e-41 |
| FC064413 | 74 | 5 | 78 | 1.99993e-41 |
| CN908480 | 93 | 5 | 97 | 1.99993e-41 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
