| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000146296 |
| Family | CE8 |
| Protein Properties | Length: 150 Molecular Weight: 17251.6 Isoelectric Point: 9.6585 |
| Chromosome | Chromosome/Scaffold: 000349192 Start: 1992 End: 2832 |
| Description | pectin methylesterase PCR fragment F |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CE8 | 53 | 138 | 6.1e-22 |
| IIMSKNDNGAYKTIAEAIKKTPEYSSRQTIIYVKAGRYEEKNLKVGRKKTNLMFVGDEKSKTVITSEKNVSHNLTTFHTASFGTVC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 150 Download |
| MEAYRADDNY DYLFKVVLIG DSSIEKSNLL AVHEERVQPR IQVHHWRQIQ ADIIMSKNDN 60 GAYKTIAEAI KKTPEYSSRQ TIIYVKAGRY EEKNLKVGRK KTNLMFVGDE KSKTVITSEK 120 NVSHNLTTFH TASFGTVCKE EMRGRTMAGY 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02468 | PLN02468 | 2.0e-19 | 22 | 149 | 140 | + putative pectinesterase/pectinesterase inhibitor | ||
| PLN02301 | PLN02301 | 9.0e-20 | 47 | 137 | 91 | + pectinesterase/pectinesterase inhibitor | ||
| PLN02506 | PLN02506 | 4.0e-21 | 44 | 133 | 90 | + putative pectinesterase/pectinesterase inhibitor | ||
| pfam01095 | Pectinesterase | 2.0e-29 | 52 | 137 | 86 | + Pectinesterase. | ||
| PLN02484 | PLN02484 | 3.0e-45 | 48 | 134 | 87 | + probable pectinesterase/pectinesterase inhibitor | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAE98780.1 | 9e-35 | 48 | 135 | 280 | 367 | pectinesterase like protein [Arabidopsis thaliana] |
| DDBJ | BAF42038.1 | 3e-35 | 48 | 134 | 299 | 385 | pectin methylesterase 1 [Pyrus communis] |
| EMBL | CBI23005.1 | 8e-38 | 49 | 134 | 34 | 119 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_200149.1 | 6e-34 | 49 | 134 | 270 | 355 | PMEPCRF (PECTIN METHYLESTERASE PCR FRAGMENT F); pectinesterase [Arabidopsis thaliana] |
| RefSeq | XP_002278061.1 | 1e-37 | 49 | 134 | 280 | 365 | PREDICTED: similar to pectin methylesterase 1 [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 7e-16 | 49 | 137 | 5 | 92 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 0.0000000000002 | 49 | 137 | 1 | 88 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2gzh_A | 0.000004 | 7 | 31 | 5 | 29 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2gzd_B | 0.000004 | 7 | 31 | 5 | 29 | A Chain A, Crystal Structure Of Rab11 In Complex With Rab11-Fip2 |
| PDB | 2gzd_A | 0.000004 | 7 | 31 | 5 | 29 | A Chain A, Crystal Structure Of Rab11 In Complex With Rab11-Fip2 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CV567398 | 94 | 41 | 134 | 9.94922e-44 |
| GO500363 | 87 | 48 | 134 | 2.99878e-43 |
| CN900192 | 92 | 43 | 134 | 3.9937e-43 |
| DT040779 | 117 | 18 | 134 | 3.9937e-43 |
| CN941107 | 87 | 48 | 134 | 5.00264e-43 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |