CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000150485
FamilyGT1
Protein PropertiesLength: 453 Molecular Weight: 51230.8 Isoelectric Point: 5.033
ChromosomeChromosome/Scaffold: 008617318 Start: 1597 End: 3703
DescriptionUDP-glucosyl transferase 85A2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12564291.1e-33
  CSEWLDKKKPNSVVYVNYGSITMMTDQHLIEFAWGLANSKQPFLWIVRADVVKGDSPILPDEFFEEIKDRGYIAGWCAQDQVLAHPSVGVFLTHSGWNST
  IESISHGVPVICWPFFAEQQTNCRYSCTTWEIGMEVSPDVKRDEIEALVKEMMEGXGGIKMREKAKEWKKKAVE
Full Sequence
Protein Sequence     Length: 453     Download
MMQLAKLLHS RGFHITFVNT EFNHNRLIRS NGPDSVKGLP DFVFETIPDG LPPSDKDGTQ    60
DIPALCDSIK KTCFGPFKEL VAKINSSSQV PQVTCIVADG IMTFGCKAAR ELGIPEVVLW    120
TASACGFMGY LQYNELVKRG IIPFKDENFM HDGTLDTPID WIPGMKNVRL KDIPSFIRVT    180
DLXDIMFNYL GSEARNCLNS XAILFNTFDE FEHEVLEVIX IMFPNIYTIG PFNLLGRHFP    240
ESKSLNSSLW KEDIKCSEWL DKKKPNSVVY VNYGSITMMT DQHLIEFAWG LANSKQPFLW    300
IVRADVVKGD SPILPDEFFE EIKDRGYIAG WCAQDQVLAH PSVGVFLTHS GWNSTIESIS    360
HGVPVICWPF FAEQQTNCRY SCTTWEIGME VSPDVKRDEI EALVKEMMEG XGGIKMREKA    420
KEWKKKAVEA TDVGGSSYNN FERLFKEVLQ LGE 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02173PLN021731.0e-493448459+
PLN02534PLN025345.0e-521451489+
PLN02448PLN024483.0e-671451472+
PLN02555PLN025551.0e-711448468+
PLN02410PLN024104.0e-781444452+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002268162.10145225479PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002268845.10145026477PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306303.10144925476predicted protein [Populus trichocarpa]
RefSeqXP_002513010.10244926476UDP-glucuronosyltransferase, putative [Ricinus communis]
RefSeqXP_002529831.10244926477UDP-glucuronosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A0144925478A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2c9z_A093441113443A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2c1z_A093441113443A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2c1x_A093441113443A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB2vg8_A5.60519e-45643729456A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO77792945414500
EG63125445614490
HO797374370444100
ES790817347974410
CO121754294603510
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_050_00022.1Aquca_010_00166.1Aquca_010_00171.1Aquca_016_00020.1Aquca_010_00173.1
Aquca_016_00023.1Aquca_057_00092.1Aquca_028_00117.1Aquca_012_00168.1Aquca_028_00116.1
Aquca_033_00125.1Aquca_008_00276.1Aquca_010_00165.1Aquca_010_00172.1Aquca_039_00125.1
Aquca_093_00001.2Aquca_093_00001.1Aquca_016_00021.1Aquca_028_00265.1Aquca_039_00119.1
Aquca_012_00129.1Aquca_104_00008.1Aquca_028_00113.1Aquca_012_00237.1Aquca_012_00022.1
Aquca_028_00114.1Aquca_039_00120.1Aquca_010_00170.1Aquca_006_00132.1
Arabidopsis lyrata472480319356313123881781313121
335478472476472478476994
Arabidopsis thalianaAT1G22380.1AT1G22340.1AT1G78270.1AT1G22400.1AT1G22360.1
AT1G22370.1AT1G22370.2AT1G22360.2
Brachypodium distachyonBradi3g58700.1Bradi3g58680.1Bradi3g58670.1Bradi3g46855.1Bradi1g20190.1
Bradi5g11950.1Bradi5g06377.1Bradi3g46557.1Bradi3g46870.1Bradi5g08895.1
Bradi4g23757.1Bradi5g11230.1Bradi3g46547.1Bradi1g45567.1Bradi3g15935.1
Brassica rapaBra012322Bra031386Bra012323Bra031387Bra012324
Bra016382Bra031388Bra008354
Carica papayaevm.model.supercontig_36.150evm.model.supercontig_36.153evm.TU.contig_32224.1evm.model.supercontig_85.124evm.model.supercontig_85.125
evm.model.supercontig_55.73
Capsella rubellaCarubv10008992mCarubv10011877mCarubv10011262mCarubv10011467mCarubv10011698m
Carubv10009316m
Citrus clementinaCiclev10025476mCiclev10025504mCiclev10001630mCiclev10000958mCiclev10004031m
Ciclev10000925mCiclev10011540mCiclev10013430mCiclev10011729m
Citrus sinensisorange1.1g022329morange1.1g022321morange1.1g022811morange1.1g012342morange1.1g012217m
orange1.1g010775morange1.1g010684morange1.1g010825morange1.1g047540morange1.1g037221m
Cucumis sativusCucsa.104310.1Cucsa.218040.1Cucsa.311540.1Cucsa.218050.1Cucsa.218060.1
Cucsa.345730.1Cucsa.218010.1Cucsa.345720.1Cucsa.218070.1Cucsa.291510.1
Cucsa.345740.3Cucsa.345740.2Cucsa.345740.1Cucsa.358270.1
Eucalyptus grandisEucgr.I02656.1Eucgr.J01276.1Eucgr.H04754.1Eucgr.H04764.1Eucgr.H04760.1
Eucgr.H04762.1Eucgr.H04759.1Eucgr.H04756.1Eucgr.H04766.1Eucgr.I00512.1
Eucgr.L02357.1Eucgr.L00508.1Eucgr.L00503.1Eucgr.L00504.1Eucgr.L00512.1
Eucgr.L00994.1Eucgr.F00343.1Eucgr.L00991.1Eucgr.F00339.1Eucgr.F00340.1
Eucgr.F00348.1Eucgr.F00338.1Eucgr.L00599.1Eucgr.B01109.1Eucgr.F03595.1
Eucgr.E01564.1Eucgr.F00353.1Eucgr.F00337.1Eucgr.G02220.1Eucgr.G02217.1
Eucgr.L00511.1Eucgr.I02647.1Eucgr.G03386.1Eucgr.G02216.2Eucgr.G02215.2
Eucgr.L00502.1Eucgr.G02216.1Eucgr.G02215.1Eucgr.F03599.1Eucgr.F03601.1
Eucgr.F03591.1Eucgr.F03596.1Eucgr.F00346.1Eucgr.F03592.1Eucgr.F00340.2
Eucgr.E01567.1Eucgr.E01562.1Eucgr.L02355.1Eucgr.F00351.1Eucgr.F00342.1
Eucgr.F00349.1Eucgr.A01595.1
Fragaria vescamrna34573.1-v1.0-hybridmrna34574.1-v1.0-hybrid
Glycine maxGlyma02g25930.1Glyma08g19000.1Glyma13g14190.1Glyma20g05700.1Glyma18g01950.2
Glyma15g05980.1Glyma19g04570.1Glyma19g04610.1Glyma15g06000.1Glyma15g37520.1
Glyma13g01690.1Glyma14g35270.1Glyma14g35220.1Glyma14g35190.1Glyma06g10733.1
Glyma14g35160.1Glyma15g05700.1Glyma02g35121.1
Gossypium raimondiiGorai.003G040100.1Gorai.013G060700.1Gorai.013G060500.1Gorai.013G060400.1Gorai.009G235700.1
Linum usitatissimumLus10025741Lus10000993Lus10024584Lus10041055Lus10035903
Lus10024583Lus10032220Lus10031388Lus10032218Lus10010943
Lus10010665Lus10007421Lus10013924Lus10019364Lus10013923
Lus10017542Lus10000632Lus10013920Lus10013919Lus10013925
Lus10013921Lus10013922Lus10039277
Malus domesticaMDP0000289413MDP0000124522MDP0000134572MDP0000213111MDP0000589403
MDP0000780011MDP0000682471MDP0000879480MDP0000180882MDP0000182819
MDP0000683535MDP0000504599MDP0000259360MDP0000915151MDP0000950422
MDP0000154932MDP0000177468MDP0000185209MDP0000219696MDP0000256195
MDP0000213638MDP0000196677MDP0000246186MDP0000124585MDP0000813186
MDP0000292218MDP0000498524MDP0000552871MDP0000311467MDP0000120322
MDP0000188794MDP0000841540MDP0000200450MDP0000283230MDP0000193401
MDP0000150721MDP0000133911MDP0000156988MDP0000185273MDP0000175678
MDP0000159635MDP0000176595MDP0000508014MDP0000124584MDP0000219950
MDP0000194392MDP0000299860MDP0000212461
Manihot esculentacassava4.1_026422mcassava4.1_006558mcassava4.1_006561mcassava4.1_025925mcassava4.1_006353m
cassava4.1_029261mcassava4.1_013933mcassava4.1_006649mcassava4.1_005558mcassava4.1_021191m
cassava4.1_010735mcassava4.1_006654mcassava4.1_033520mcassava4.1_031484mcassava4.1_023166m
cassava4.1_025238mcassava4.1_030305mcassava4.1_028696m
Medicago truncatulaMedtr3g079480.1Medtr1g100520.1Medtr6g014270.1Medtr6g014050.1Medtr3g008010.1
Medtr6g014250.1Medtr6g014150.1Medtr6g014190.1Medtr6g013900.1Medtr6g014470.1
Medtr6g014310.1Medtr6g014240.1Medtr6g014170.1Medtr6g014187.1Medtr5g058320.1
Medtr6g014200.1Medtr5g064240.1Medtr6g014340.1Medtr6g014290.1Medtr7g011470.1
Medtr4g094220.1Medtr6g013920.1Medtr6g013990.1Medtr6g014040.1Medtr6g014220.1
Medtr6g014020.1Medtr6g014580.1Medtr6g013960.1Medtr8g043470.1Medtr4g033620.1
Medtr2g008210.1Medtr6g014300.1
Mimulus guttatusmgv1a025300mmgv1a005711mmgv1a005587mmgv1a024760mmgv1a005689m
mgv1a005383mmgv1a005662mmgv1a018722mmgv1a025645mmgv1a006002m
mgv1a021775mmgv1a023488m
Oryza sativaLOC_Os02g51910.1LOC_Os02g51900.1LOC_Os02g51930.1LOC_Os04g25380.1LOC_Os04g25970.1
LOC_Os02g36830.1LOC_Os04g25980.1LOC_Os04g37820.1LOC_Os02g36840.1LOC_Os08g31200.1
LOC_Os04g25440.1LOC_Os04g25370.1LOC_Os04g24850.1LOC_Os04g25800.1LOC_Os02g28900.1
LOC_Os04g25490.1LOC_Os02g36810.1LOC_Os08g07200.1LOC_Os06g11720.1
Panicum virgatumPavirv00012781mPavirv00030800mPavirv00023457mPavirv00017384mPavirv00001927m
Pavirv00067140mPavirv00008304mPavirv00003072mPavirv00022369mPavirv00048885m
Pavirv00003087mPavirv00035729mPavirv00047416mPavirv00008112mPavirv00016911m
Pavirv00052190mPavirv00002582mPavirv00043932mPavirv00048044mPavirv00064463m
Pavirv00051913mPavirv00006307mPavirv00044179mPavirv00040421mPavirv00023047m
Pavirv00027257mPavirv00039402mPavirv00057091mPavirv00051079mPavirv00052414m
Pavirv00037566mPavirv00023046mPavirv00055518mPavirv00048975m
Phaseolus vulgarisPhvul.006G017500.1Phvul.008G175500.1Phvul.004G043600.1Phvul.008G175300.1Phvul.006G017600.1
Phvul.008G174700.1Phvul.006G205600.1Phvul.004G043400.1Phvul.004G043200.1Phvul.004G042900.1
Phvul.006G205500.1Phvul.006G205700.1Phvul.004G043300.1Phvul.008G175600.1Phvul.004G043500.1
Phvul.006G017400.1Phvul.011G158500.1Phvul.004G043100.1Phvul.004G043000.1
Picea abiesMA_10436276g0020MA_167914g0010MA_167603g0010MA_22116g0010MA_10434089g0020
MA_224931g0010MA_10427096g0010MA_9514701g0010MA_10434089g0010MA_10284226g0010
MA_10172523g0010MA_10431252g0010.641.827MA_10431252g0010.641.827MA_281794g0010MA_167774g0010
MA_10426668g0010MA_10436413g0010MA_95435g0010MA_3747445g0010MA_9029785g0010
MA_207926g0010.80.201MA_207926g0010.80.201MA_158653g0010MA_86064g0010MA_10426668g0020
Populus trichocarpaPotri.005G073800.1Potri.007G095000.1Potri.001G313000.1Potri.016G021500.1Potri.016G022000.1
Potri.002G098300.1Potri.006G023600.1Potri.016G022100.1Potri.006G023100.3Potri.016G022400.2
Potri.016G022400.1Potri.004G172700.2Potri.004G172700.1Potri.006G022300.1Potri.006G023700.1
Potri.017G052300.1Potri.007G132400.1Potri.T148700.1Potri.006G023100.2Potri.006G023100.1
Potri.006G022800.1Potri.002G098400.1Potri.017G052400.1Potri.016G022500.1Potri.001G312600.1
Potri.T181000.1Potri.016G021000.1Potri.016G020800.2Potri.016G020800.1Potri.017G052000.2
Potri.017G052000.1Potri.006G022500.1Potri.016G021600.1Potri.016G021100.1Potri.006G022600.1
Potri.016G020400.1Potri.017G052100.2Potri.017G052100.1Potri.016G021200.1Potri.016G021700.1
Potri.016G021800.1Potri.016G020700.1Potri.016G020900.1Potri.016G020500.1Potri.016G021300.1
Potri.006G023000.1
Prunus persicappa018343mppa021414mppa017055mppa026557mppa015357m
ppa004968mppa005043mppa023851mppa021058mppa004909m
ppa004956mppa004979mppa020820mppa004945mppa004989m
ppa018697mppa019145mppb015490m
Ricinus communis27561.m00029628492.m00046630131.m00714627956.m00035029806.m000962
27956.m00035229806.m00096329806.m00096129806.m00096429806.m000960
27956.m00034929908.m00605029848.m00468829908.m00604829908.m006049
Setaria italicaSi017031mSi017045mSi009951mSi017055mSi017025m
Si009941mSi016991mSi028377mSi028384mSi009917m
Si016809mSi017086mSi017064mSi020070mSi029646m
Si006315mSi019905mSi015022m
Sorghum bicolorSb01g001220.1Sb06g018460.1Sb04g027420.1Sb04g027460.1Sb04g027470.1
Sb04g023920.1Sb04g023930.1Sb09g023700.1Sb06g018490.1Sb10g009800.1
Sb02g030370.1Sb10g025750.1Sb07g021090.1Sb04g023530.1Sb02g039670.1
Sb10g007700.1Sb07g004500.1
Thellungiella halophilaThhalv10007502mThhalv10007489mThhalv10009957m.282.458Thhalv10009957m.282.458Thhalv10007499m
Thhalv10009957m.570.750Thhalv10009957m.570.750Thhalv10019687m
Vitis viniferaGSVIVT01015729001GSVIVT01006626001GSVIVT01009052001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)