y PlantCAZyme

CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000158437
FamilyGT90
Protein PropertiesLength: 791 Molecular Weight: 90478 Isoelectric Point: 9.4199
ChromosomeChromosome/Scaffold: 000357185 Start: 8842 End: 16687
DescriptionArabidopsis thaliana protein of unknown function (DUF821)
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT904707020
  KVPDLELMFDCVDWPVIYQGSIAGPIPLLHHPCFATAVMTVHSILSSLIGHFGDEEGNKRSKWIDREPYAYWKGNPSVAETRKDLVKCNVSDQMDWNARI
  YAQDWLKEIKEGYKQSDLASQCVHRYKIYIEGSAWSVSEKYILACDSVTFIVKPRYYDFFTRGLMPVHHYWPIKDDDKCRSIKFAVDWGNSHKKKAQSIG
  KAARKMILQDLKMDYVYDYMFHLLSEYSKLLQF
Full Sequence
Protein Sequence     Length: 791     Download
MALFTRNLVL VLFLLTITLC DAGISIHRKR RHVRVKNFLQ LNGTLFTLTL HCKSKDDDLG    60
KKVIPFNGSW EFDFIPHFLG ATLYFCGFAW PGQFKWFNVY NDDRDIDRAI WRQLASTWKH    120
ILHIQGLELS PPQSANHPHF VNIFCCEILT SNHGYVSVSP DFASHVLKKA FDAGPASIHT    180
QILNITGVYS VQVFPGIPKY QKISVVLAPS LPPPSTSSGI ISNSTHNYPT KTQPFSISSK    240
PDAPPSSAPY RFNQPKRNPT HFRKPVPPPT QLIKSLESDS NFGSESWSSE NKREGKRSPA    300
RFSAVFVFVF LSLGAFVCTR LLNFPTIVDT SAQGSIVTTR ASQNYPHKTS YIPKKPPPKL    360
EFPLNCTAYD LTRTCPSNYP TTFNPEQDPD SPSPPPTCPE YFRWIYEDLR PWAHTGITKD    420
MVQSAKRTAN FKLVIMKGKA YVETYQNSFQ TRDVFTLWGI LQLLRRYPGK VPDLELMFDC    480
VDWPVIYQGS IAGPIPLLHH PCFATAVMTV HSILSSLIGH FGDEEGNKRS KWIDREPYAY    540
WKGNPSVAET RKDLVKCNVS DQMDWNARIY AQDWLKEIKE GYKQSDLASQ CVHRYKIYIE    600
GSAWSVSEKY ILACDSVTFI VKPRYYDFFT RGLMPVHHYW PIKDDDKCRS IKFAVDWGNS    660
HKKKAQSIGK AARKMILQDL KMDYVYDYMF HLLSEYSKLL QFKPTIPRKA VELCSEAMVC    720
QAQGLEKKLQ GLEKKFMMES LVKGPAERNP CAMPPPYDPA TLFAVLRRQS NSIKQVETWE    780
RSYWENQSKQ S                                                         840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam05938Self-incomp_S18.0e-183210879+
pfam05686Glyco_transf_902.0e-40658780123+
pfam05686Glyco_transf_902.0e-60397552171+
smart00672CAP103.0e-92470703256+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI34690.1035479056496unnamed protein product [Vitis vinifera]
RefSeqNP_197774.1034578987539unknown protein [Arabidopsis thaliana]
RefSeqXP_002268245.1031978851524PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002510787.1034179149506KDEL motif-containing protein 1 precursor, putative [Ricinus communis]
RefSeqXP_002510788.1029979132528KDEL motif-containing protein 1 precursor, putative [Ricinus communis]
Transmembrane Domains
StartEnd
426
302324
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO7231892913976700
GO5359711945287210
EE6162812455327760
AM7301222465247690
EE6200152435277690
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_038_00046.1Aquca_004_00351.1Aquca_045_00089.1
Arabidopsis lyrata910396485256483721887933486604
483723475010
Arabidopsis thalianaAT5G23850.1AT3G48980.1AT3G61290.1AT3G61280.1AT2G45830.2
AT2G45830.1AT2G45840.1AT1G07220.1AT3G61270.1AT1G63420.1
AT3G61280.2
Brachypodium distachyonBradi3g50030.1Bradi5g16810.1Bradi5g16797.1Bradi2g07460.1Bradi1g61560.1
Bradi2g35840.1
Brassica rapaBra018021Bra009709Bra007591Bra007592Bra014445
Bra007593Bra003444Bra007590Bra031558Bra015563
Bra027639Bra004942Bra039310
Carica papayaevm.model.supercontig_18.237evm.model.supercontig_112.24evm.model.supercontig_18.236evm.model.supercontig_107.57
Capsella rubellaCarubv10000648mCarubv10016976mCarubv10019114mCarubv10016988mCarubv10008891m
Carubv10020086mCarubv10018865mCarubv10025566mCarubv10025651m
Chlamydomonas reinhardtiiCre02.g117650.t1.3Cre09.g413500.t1.3Cre12.g531750.t1.2Cre14.g621800.t1.3
Citrus clementinaCiclev10007061mCiclev10023948mCiclev10019760mCiclev10004696mCiclev10019647m
Ciclev10028388mCiclev10020660mCiclev10020252mCiclev10021346mCiclev10020817m
Ciclev10006549m
Citrus sinensisorange1.1g043671morange1.1g044043morange1.1g017178morange1.1g016930morange1.1g011607m
orange1.1g009387morange1.1g011592morange1.1g046815morange1.1g017360morange1.1g022616m
orange1.1g022102morange1.1g022101morange1.1g039857m
Cucumis sativusCucsa.107800.1Cucsa.107750.1Cucsa.135430.1Cucsa.302970.1Cucsa.147060.1
Cucsa.107720.1
Eucalyptus grandisEucgr.A02783.1Eucgr.D01868.1Eucgr.D01866.1Eucgr.E00165.1Eucgr.E00167.1
Eucgr.E00163.1Eucgr.J01883.1Eucgr.D02274.1Eucgr.I01244.1Eucgr.E00171.1
Eucgr.E00168.1Eucgr.E00166.1Eucgr.D01868.3Eucgr.D01868.2.50.190Eucgr.D01868.2.50.190
Eucgr.D01868.2.190.261Eucgr.D01868.2.190.261
Fragaria vescamrna32446.1-v1.0-hybrid.718.966mrna32446.1-v1.0-hybrid.718.966mrna32446.1-v1.0-hybrid.207.452mrna32446.1-v1.0-hybrid.207.452mrna13268.1-v1.0-hybrid.664.916
mrna13268.1-v1.0-hybrid.664.916mrna19062.1-v1.0-hybridmrna07900.1-v1.0-hybridmrna13268.1-v1.0-hybrid.179.419mrna13268.1-v1.0-hybrid.179.419
Glycine maxGlyma16g31231.2Glyma16g31231.1Glyma16g31231.4Glyma16g31231.3Glyma03g01480.2
Glyma09g25490.2Glyma01g42740.2Glyma01g42740.1Glyma07g07910.2Glyma07g08000.2
Glyma03g01490.3Glyma03g01490.2Glyma03g01490.1Glyma18g07010.1Glyma11g27050.2
Glyma11g27050.1Glyma03g01580.2Glyma18g46490.1Glyma09g39700.1Glyma0920s00200.1
Glyma16g30430.2Glyma16g30561.1Glyma16g30313.1Glyma16g31241.1
Gossypium raimondiiGorai.004G157700.1Gorai.007G098000.1Gorai.008G277100.1Gorai.007G097900.1Gorai.008G246000.1
Gorai.007G097800.1Gorai.001G116200.1Gorai.008G118500.1.121.260Gorai.008G118500.1.121.260Gorai.008G118500.1.262.331
Gorai.008G118500.1.262.331
Linum usitatissimumLus10039228Lus10040665Lus10018239Lus10039226Lus10024519
Lus10027472Lus10027473Lus10037863.306.434Lus10037863.306.434Lus10008017
Lus10037864.295.404Lus10037864.295.404Lus10037864.182.299Lus10037864.182.299Lus10037863.212.306
Lus10037863.212.306
Malus domesticaMDP0000322698MDP0000322697MDP0000322107MDP0000167387MDP0000289383
MDP0000239614MDP0000147543MDP0000304021MDP0000246269MDP0000261453
MDP0000151647
Manihot esculentacassava4.1_032880mcassava4.1_028860mcassava4.1_005486mcassava4.1_025567mcassava4.1_027328m
cassava4.1_006037mcassava4.1_007061m.169.306cassava4.1_007061m.169.306cassava4.1_007061m.306.383cassava4.1_007061m.306.383
Medicago truncatulaMedtr6g031170.1Medtr7g076890.1Medtr7g076860.1Medtr5g010500.1Medtr6g031200.1
Medtr6g031190.1
Mimulus guttatusmgv1a020993mmgv1a004518mmgv1a010063m
Oryza sativaLOC_Os02g42920.1LOC_Os04g45160.1LOC_Os04g45140.1LOC_Os05g05690.1LOC_Os08g01150.1
LOC_Os04g45160.2LOC_Os06g05940.1
Panicum virgatumPavirv00027487mPavirv00066339mPavirv00043004mPavirv00000938mPavirv00017588m
Pavirv00066593mPavirv00063931mPavirv00046116mPavirv00058150mPavirv00052814m
Pavirv00002686mPavirv00035277mPavirv00024822mPavirv00027719mPavirv00069435m
Pavirv00064656mPavirv00033981mPavirv00004308mPavirv00021245m.180.302Pavirv00021245m.180.302
Pavirv00063538mPavirv00021245m.77.169Pavirv00021245m.77.169
Phaseolus vulgarisPhvul.004G116000.1Phvul.010G096100.1Phvul.010G096500.1Phvul.006G068300.1
Picea abiesMA_53054g0010MA_32961g0010MA_116478g0010MA_55748g0010MA_10425862g0010
MA_689724g0010MA_129161g0010MA_10435424g0020MA_23554g0010MA_912717g0010
MA_9597898g0010MA_4631294g0010
Populus trichocarpaPotri.015G144400.2Potri.015G144400.1Potri.003G125000.3Potri.003G125000.2Potri.003G125000.1
Potri.014G081600.1Potri.001G252000.1Potri.002G157800.2Potri.002G157800.1Potri.002G157900.1
Prunus persicappa023179mppa005169mppa004159mppa014578mppa024728m
ppa019065mppa008339mppa026562m
Ricinus communis30147.m01373930147.m01374030174.m00900430174.m00900529681.m001352
30190.m011190
Setaria italicaSi035011mSi016818mSi009846mSi009843mSi024592m
Si012640mSi006188mSi025803mSi013493mSi039647m
Si008749m
Selaginella moellendorffii10148312256141909153405442089
6285062763910456480381791
6314353728
Sorghum bicolorSb06g023680.1Sb04g033620.1Sb06g023670.1Sb09g003810.1Sb10g003730.1
Sb07g000280.1
Thellungiella halophilaThhalv10003948mThhalv10010269mThhalv10005889mThhalv10023375mThhalv10006441m
Thhalv10001309m.50.298Thhalv10001309m.50.298Thhalv10001309m.501.754Thhalv10001309m.501.754Thhalv10007804m
Vitis viniferaGSVIVT01028972001GSVIVT01026877001.101.348GSVIVT01026877001.101.348GSVIVT01019779001GSVIVT01026877001.483.731
GSVIVT01026877001.483.731GSVIVT01026872001GSVIVT01024736001GSVIVT01026876001GSVIVT01026878001
GSVIVT01026871001.50.297GSVIVT01026871001.50.297GSVIVT01026871001.50.297GSVIVT01026873001GSVIVT01028968001
GSVIVT01026871001.476.608GSVIVT01026871001.476.608GSVIVT01026871001.476.608GSVIVT01026871001.628.756GSVIVT01026871001.628.756
GSVIVT01026871001.628.756GSVIVT01026874001
Volvox carteriVocar20006148mVocar20001995m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)