y PlantCAZyme

CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000165459
FamilyGT29
Protein PropertiesLength: 476 Molecular Weight: 54058.8 Isoelectric Point: 9.3057
ChromosomeChromosome/Scaffold: 001307439 Start: 489 End: 3320
DescriptionMALE GAMETOPHYTE DEFECTIVE 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT291583541.10002e-42
  KKCYNKTLCEEHLNVLLPAKPPFHPRQFRTCAVVGNSGDLLMTEFGKEIDSHDAVIRDNEAPVNEKYAKYVGMKRDFRLVVRGAARNMVSILNGSADEVL
  IIKSVTHKDFNAMIKSITNPVYLFQGIVLRRGAKGTGMKSVELALSICDIVDIYGFTVDPGYTEWTRYFSTPRKGHNPLQGRAYYQLLECLGVIRIH
Full Sequence
Protein Sequence     Length: 476     Download
MRSHRQASSS NNLNRRPTIL YLVCSVAFFS LLLFAIQSSL FAGNQKLDLH TQXDVRVLSE    60
FQSTVKQCVA NRGLGLTAHI IDHCNLTLKF PEGTNSTWYN EQFKKFEALE YHYNVCEALL    120
LWEQYRNMTT VLTREYLDVR PKGWEEYAAQ RIAQLGTKKC YNKTLCEEHL NVLLPAKPPF    180
HPRQFRTCAV VGNSGDLLMT EFGKEIDSHD AVIRDNEAPV NEKYAKYVGM KRDFRLVVRG    240
AARNMVSILN GSADEVLIIK SVTHKDFNAM IKSITNPVYL FQGIVLRRGA KGTGMKSVEL    300
ALSICDIVDI YGFTVDPGYT EWTRYFSTPR KGHNPLQGRA YYQLLECLGV IRIHSPMRSK    360
RKQDWSDVPS REMIGRAHAA ALRLKRGEAG DLGQFGSCKV SGNVDADKVG PVSGSPDMSD    420
KRKFSNYNKW EVLPFKSLRK EAQDHYIQME GVSLYKMDGN KLDDLVCVRH SLKSDV        480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_293.0e-47146357255+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI21279.1014721473unnamed protein product [Vitis vinifera]
RefSeqNP_850940.1014761474glycosyl transferase family 29 protein / sialyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002275669.10546549508PREDICTED: hypothetical protein, partial [Vitis vinifera]
RefSeqXP_002320429.10144766474predicted protein [Populus trichocarpa]
RefSeqXP_002512844.1014501444alpha-2,8-sialyltransferase 8b, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wnf_A0.0000000000418633898266A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB2wnb_A0.0000000000418633898266A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
PDB2wml_A0.0000000000418633898266A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
Transmembrane Domains
StartEnd
1941
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK254085321133330
DR9147972981134070
EY7151712871824680
JK9890602692094740
DY67329229112870
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00108.5Aquca_019_00142.1Aquca_004_00108.4Aquca_004_00108.3Aquca_004_00108.2
Aquca_004_00108.1
Arabidopsis lyrata906136470934
Arabidopsis thalianaAT3G48820.2AT3G48820.1AT1G08660.1AT1G08660.2
Brachypodium distachyonBradi3g01700.2Bradi3g01700.3Bradi3g01700.1Bradi1g67467.1
Brassica rapaBra019569Bra031637
Carica papayaevm.model.supercontig_4.113evm.model.supercontig_70.73
Capsella rubellaCarubv10017505mCarubv10017208mCarubv10009607mCarubv10009038m
Citrus clementinaCiclev10031577mCiclev10031575mCiclev10031902m
Citrus sinensisorange1.1g013814morange1.1g013792morange1.1g017903morange1.1g017882morange1.1g022244m
orange1.1g019465morange1.1g011883m
Cucumis sativusCucsa.014710.2Cucsa.014710.1Cucsa.156010.2Cucsa.156010.1
Eucalyptus grandisEucgr.F04117.1Eucgr.I01604.1Eucgr.G01933.1
Fragaria vescamrna06450.1-v1.0-hybridmrna01393.1-v1.0-hybrid
Glycine maxGlyma05g34110.1Glyma08g05580.4Glyma08g05580.3Glyma08g05580.1Glyma08g05580.2
Glyma19g27546.1Glyma16g05340.1
Gossypium raimondiiGorai.008G209800.2Gorai.008G209800.1Gorai.005G137400.2Gorai.005G137400.1Gorai.005G137400.3
Linum usitatissimumLus10032547Lus10043193Lus10035162Lus10031992
Malus domesticaMDP0000239581MDP0000149927MDP0000211019MDP0000304668MDP0000244138
Manihot esculentacassava4.1_007830mcassava4.1_008832m
Medicago truncatulaMedtr7g084010.1Medtr8g099840.2Medtr8g099840.1
Mimulus guttatusmgv1a023151mmgv1a005647m
Oryza sativaLOC_Os02g02620.1LOC_Os11g36420.1
Panicum virgatumPavirv00016935mPavirv00068699mPavirv00023972mPavirv00062875mPavirv00062874m
Physcomitrella patensPp1s457_24V6.1Pp1s209_60V6.1
Phaseolus vulgarisPhvul.002G327200.1Phvul.001G084900.1
Picea abiesMA_30391g0010MA_932319g0010
Populus trichocarpaPotri.015G104100.1Potri.014G145400.2Potri.014G145400.1
Prunus persicappa005917mppa005273m
Ricinus communis30147.m01442930131.m006986
Setaria italicaSi017190mSi026296m
Selaginella moellendorffii406168831178267676584403717
760757656779823
Sorghum bicolorSb04g001370.1Sb05g022210.1
Thellungiella halophilaThhalv10010382mThhalv10007525m
Vitis viniferaGSVIVT01008625001GSVIVT01032992001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)