Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000172043 |
Family | GT1 |
Protein Properties | Length: 150 Molecular Weight: 16745.3 Isoelectric Point: 6.788 |
Chromosome | Chromosome/Scaffold: 004302141 Start: 1430 End: 1932 |
Description | UDP-glucosyl transferase 76E2 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 2 | 126 | 2.5e-25 |
AWGLANSKQPFLWVIRPGSVSGSDGIELLPQGFVEAIGERVGGFWSHCGWNSTLESLSEGIPMICLPSFGDQKVHSRYVSQVWKVGLHLDNELERGEIER AVRKLMVDADGEVMRVRAKDLKEKI |
Full Sequence |
---|
Protein Sequence Length: 150 Download |
MAWGLANSKQ PFLWVIRPGS VSGSDGIELL PQGFVEAIGE RVGGFWSHCG WNSTLESLSE 60 GIPMICLPSF GDQKVHSRYV SQVWKVGLHL DNELERGEIE RAVRKLMVDA DGEVMRVRAK 120 DLKEKIEVSL RNGGSSYKFL NKLVELIMSL |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02555 | PLN02555 | 2.0e-25 | 1 | 145 | 168 | + limonoid glucosyltransferase | ||
PLN00164 | PLN00164 | 2.0e-28 | 2 | 148 | 179 | + glucosyltransferase; Provisional | ||
PLN02992 | PLN02992 | 9.0e-30 | 1 | 145 | 182 | + coniferyl-alcohol glucosyltransferase | ||
PLN02448 | PLN02448 | 4.0e-32 | 1 | 147 | 163 | + UDP-glycosyltransferase family protein | ||
PLN02410 | PLN02410 | 2.0e-55 | 2 | 150 | 166 | + UDP-glucoronosyl/UDP-glucosyl transferase family protein |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002299843.1 | 0 | 1 | 147 | 286 | 449 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002314141.1 | 0 | 1 | 150 | 295 | 461 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002520465.1 | 0 | 1 | 150 | 296 | 453 | UDP-glucuronosyltransferase, putative [Ricinus communis] |
RefSeq | XP_002520467.1 | 0 | 1 | 149 | 286 | 451 | UDP-glucuronosyltransferase, putative [Ricinus communis] |
RefSeq | XP_002525942.1 | 0 | 1 | 149 | 261 | 426 | UDP-glucuronosyltransferase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2pq6_A | 8e-35 | 2 | 148 | 317 | 478 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vg8_A | 4e-23 | 1 | 141 | 289 | 461 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vch_A | 4e-23 | 1 | 141 | 289 | 461 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vce_A | 4e-23 | 1 | 141 | 289 | 461 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2c9z_A | 4e-16 | 1 | 147 | 292 | 450 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GO549086 | 167 | 1 | 150 | 0 |
EG631253 | 167 | 1 | 150 | 0 |
CV658291 | 167 | 1 | 150 | 0 |
EG669587 | 166 | 1 | 149 | 0 |
BQ411181 | 167 | 1 | 150 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|