y PlantCAZyme

CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000180317
FamilyGH1
Protein PropertiesLength: 196 Molecular Weight: 22847.8 Isoelectric Point: 6.1631
ChromosomeChromosome/Scaffold: 008429422 Start: 1814 End: 3810
Descriptionbeta glucosidase 42
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1151960
  VKDKQGGQVGLVVDCEWAEANSDTIEDKVAAARRLDFQLGWYLDPIYHGEYPKVMRERLGDRLPIFSEKDKELLKNSVDFIGLNHYASRFIAHGRDNHDK
  GDFYKAQGIEKIASEWLYVVPWGMHKVLNYKAQRYNNPPIYVTENGMDDEDNDTSPLHEMLDDKLRVSYFKRYLSAVAKAIR
Full Sequence
Protein Sequence     Length: 196     Download
FHVKCNECEI DWKTVKDKQG GQVGLVVDCE WAEANSDTIE DKVAAARRLD FQLGWYLDPI    60
YHGEYPKVMR ERLGDRLPIF SEKDKELLKN SVDFIGLNHY ASRFIAHGRD NHDKGDFYKA    120
QGIEKIASEW LYVVPWGMHK VLNYKAQRYN NPPIYVTENG MDDEDNDTSP LHEMLDDKLR    180
VSYFKRYLSA VAKAIR                                                    240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02998PLN029985.0e-2636196173+
PLN02814PLN028145.0e-3316196192+
PLN02849PLN028491.0e-3416196190+
TIGR03356BGL2.0e-3520196179+
pfam00232Glyco_hydro_12.0e-4412196200+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP51059.1016196234426latex cyanogenic beta glucosidase [Hevea brasiliensis]
EMBLCBI23349.101619681273unnamed protein product [Vitis vinifera]
GenBankEEC71957.1013196223418hypothetical protein OsI_04787 [Oryza sativa Indica Group]
RefSeqXP_002265653.101319665260PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002270406.1016196771963PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A5.04467e-4416196237432A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3gnp_A5.04467e-4416196237432A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3gno_A5.04467e-4416196237432A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3f5l_B9.99995e-4119195239426A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3f5l_A9.99995e-4119195239426A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GW870470185161870
FN754931194161960
DT761284194161960
DR941241194161960
CO112186194161960
Orthologous Group
SpeciesID
Linum usitatissimumLus10026860
Malus domesticaMDP0000232427.211.480MDP0000232427.211.480MDP0000205868MDP0000221259MDP0000557372
MDP0000175648MDP0000284502.206.394MDP0000284502.206.394
Panicum virgatumPavirv00060284m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny