Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000193383 |
Family | GH19 |
Protein Properties | Length: 225 Molecular Weight: 24611 Isoelectric Point: 8.1972 |
Chromosome | Chromosome/Scaffold: 008758305 Start: 2316 End: 3247 |
Description | homolog of carrot EP3-3 chitinase |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 94 | 225 | 2.24208e-44 |
LPHVTHETGQINRGTYCDTTSTDYPCNPYGRGPLQLTWNYNYGAAGNSIGFDRLNSPETVASDPVVAFKTALWFWMNNVRPVLSQGFGATIRAINGEVEC DGKLPDAVQARTNYYKDYCNQLNVNPGGNLYC |
Full Sequence |
---|
Protein Sequence Length: 225 Download |
MVTEAAAPIT VARVVNRAPA PVALLHLPSQ VEMAPWLTSS HRTSLTESLT RLLQTAPGRN 60 FTLAMAFLML SSRNPALVGS VLLMTPNVKL QYSLPHVTHE TGQINRGTYC DTTSTDYPCN 120 PYGRGPLQLT WNYNYGAAGN SIGFDRLNSP ETVASDPVVA FKTALWFWMN NVRPVLSQGF 180 GATIRAINGE VECDGKLPDA VQARTNYYKD YCNQLNVNPG GNLYC |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
COG3179 | COG3179 | 0.009 | 123 | 168 | 46 | + Predicted chitinase [General function prediction only] |
cd00442 | lysozyme_like | 2.0e-7 | 118 | 183 | 70 | + lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides. |
pfam00182 | Glyco_hydro_19 | 1.0e-53 | 94 | 225 | 177 | + Chitinase class I. |
cd00325 | chitinase_glyco_hydro_19 | 2.0e-62 | 94 | 225 | 175 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004568 | chitinase activity |
GO:0006032 | chitin catabolic process |
GO:0016998 | cell wall macromolecule catabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACM45716.1 | 0 | 55 | 225 | 90 | 272 | class IV chitinase [Pyrus pyrifolia] |
GenBank | ACU16135.1 | 0 | 93 | 225 | 91 | 235 | unknown [Glycine max] |
GenBank | ACZ52964.1 | 0 | 58 | 225 | 50 | 227 | chitinase [Dimocarpus longan] |
RefSeq | XP_002326040.1 | 0 | 94 | 225 | 127 | 270 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002330662.1 | 0 | 49 | 225 | 87 | 275 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3hbh_A | 8.00001e-41 | 55 | 225 | 21 | 204 | A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex |
PDB | 3hbe_X | 8.00001e-41 | 55 | 225 | 21 | 204 | A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex |
PDB | 3hbd_A | 8.00001e-41 | 55 | 225 | 21 | 204 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
PDB | 2cjl_B | 2e-33 | 94 | 225 | 51 | 204 | A Chain A, Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes |
PDB | 2cjl_A | 2e-33 | 94 | 225 | 51 | 204 | A Chain A, Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EX661207 | 175 | 58 | 225 | 0 |
EX657777 | 180 | 58 | 225 | 0 |
DY671606 | 180 | 58 | 225 | 0 |
EX678024 | 180 | 58 | 225 | 0 |
EX659991 | 180 | 58 | 225 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|