Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000196383 |
Family | GH1 |
Protein Properties | Length: 125 Molecular Weight: 14727.9 Isoelectric Point: 7.8789 |
Chromosome | Chromosome/Scaffold: 013883430 Start: 2116 End: 2810 |
Description | beta glucosidase 31 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH1 | 3 | 124 | 5.60519e-45 |
SSWLVVYPKGIPKILLYTKHKYNNPLIYITENGLDEFDDPTLSXPQSLNDTHRIDYHYHHLDYLXKAINDGVNVKGYFTXSLLDNFEWASRYTLRFGFVY IDYNDGLKRHPKLSASWFKYFL |
Full Sequence |
---|
Protein Sequence Length: 125 Download |
AASSWLVVYP KGIPKILLYT KHKYNNPLIY ITENGLDEFD DPTLSXPQSL NDTHRIDYHY 60 HHLDYLXKAI NDGVNVKGYF TXSLLDNFEW ASRYTLRFGF VYIDYNDGLK RHPKLSASWF 120 KYFLG |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02814 | PLN02814 | 3.0e-23 | 10 | 124 | 116 | + beta-glucosidase | ||
PRK13511 | PRK13511 | 2.0e-29 | 7 | 121 | 119 | + 6-phospho-beta-galactosidase; Provisional | ||
COG2723 | BglB | 2.0e-31 | 8 | 121 | 114 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
TIGR03356 | BGL | 3.0e-34 | 8 | 120 | 113 | + beta-galactosidase. | ||
pfam00232 | Glyco_hydro_1 | 6.0e-38 | 1 | 121 | 124 | + Glycosyl hydrolase family 1. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABV54745.1 | 0 | 1 | 124 | 368 | 491 | cyanogenic beta-glucosidase [Trifolium repens] |
GenBank | ABV54754.1 | 0 | 1 | 124 | 368 | 491 | beta-glucosidase-like protein [Trifolium repens] |
GenBank | ABW76288.1 | 0 | 1 | 124 | 378 | 501 | beta-glucosidase G3 [Medicago truncatula] |
GenBank | ACD65511.1 | 0 | 1 | 124 | 390 | 513 | beta-glucosidase D7 [Lotus japonicus] |
DDBJ | BAG13451.1 | 0 | 1 | 124 | 407 | 530 | beta-glucosidase [Rosa hybrid cultivar] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1cbg_A | 0 | 1 | 124 | 365 | 488 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
PDB | 3ptq_B | 2.94273e-44 | 1 | 124 | 380 | 503 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
PDB | 3ptq_A | 2.94273e-44 | 1 | 124 | 380 | 503 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
PDB | 3ptm_B | 2.94273e-44 | 1 | 124 | 380 | 503 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
PDB | 3ptm_A | 2.94273e-44 | 1 | 124 | 380 | 503 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DR998205 | 125 | 1 | 125 | 0 |
DR993682 | 125 | 1 | 125 | 0 |
DR998728 | 125 | 1 | 125 | 0 |
CN995247 | 124 | 1 | 124 | 0 |
GO548879 | 125 | 1 | 125 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|