Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000198493 |
Family | CE10 |
Protein Properties | Length: 133 Molecular Weight: 14676.8 Isoelectric Point: 7.5909 |
Chromosome | Chromosome/Scaffold: 013995364 Start: 6846 End: 7247 |
Description | alpha/beta-Hydrolases superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE10 | 35 | 129 | 8.7e-31 |
TVQSKDIVISQQPLVSARLYLPKSIETKLPLLVYFHGGGFCINSAFSPTYHNYLNSLVSKANVVAVFVEYRLAPENPLPTAYDDSWAALKWVASH |
Full Sequence |
---|
Protein Sequence Length: 133 Download |
MSNEEVAYDL TPLIKVYKDG RVGRLQGTAT VPPSTVQSKD IVISQQPLVS ARLYLPKSIE 60 TKLPLLVYFH GGGFCINSAF SPTYHNYLNS LVSKANVVAV FVEYRLAPEN PLPTAYDDSW 120 AALKWVASHF DGT |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00312 | Esterase_lipase | 1.0e-6 | 53 | 132 | 98 | + Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate. | ||
pfam00135 | COesterase | 4.0e-8 | 53 | 132 | 98 | + Carboxylesterase family. | ||
COG2272 | PnbA | 8.0e-9 | 53 | 132 | 100 | + Carboxylesterase type B [Lipid metabolism] | ||
COG0657 | Aes | 7.0e-17 | 32 | 129 | 99 | + Esterase/lipase [Lipid metabolism] | ||
pfam07859 | Abhydrolase_3 | 2.0e-26 | 66 | 129 | 64 | + alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016787 | hydrolase activity |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABB89006.1 | 0 | 1 | 133 | 1 | 138 | CXE carboxylesterase [Malus pumila] |
GenBank | ACJ85164.1 | 0 | 3 | 133 | 9 | 147 | unknown [Medicago truncatula] |
EMBL | CAN61111.1 | 0 | 2 | 129 | 5 | 139 | hypothetical protein [Vitis vinifera] |
RefSeq | XP_002336023.1 | 0 | 5 | 132 | 3 | 136 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002518792.1 | 0 | 5 | 133 | 7 | 142 | catalytic, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2o7v_A | 5e-20 | 34 | 131 | 51 | 151 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
PDB | 2o7r_A | 5e-20 | 34 | 131 | 51 | 151 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 2c7b_B | 0.000000000000004 | 28 | 131 | 38 | 139 | A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library |
PDB | 2c7b_A | 0.000000000000004 | 28 | 131 | 38 | 139 | A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library |
PDB | 3zwq_B | 0.000000000000004 | 49 | 131 | 63 | 142 | A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CO900566 | 130 | 4 | 133 | 0 |
EB138184 | 138 | 1 | 133 | 0 |
EB128029 | 138 | 1 | 133 | 0 |
EB137322 | 138 | 1 | 133 | 0 |
EB151471 | 138 | 1 | 133 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|