CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000206284
FamilyGH35
Protein PropertiesLength: 915 Molecular Weight: 102135 Isoelectric Point: 9.2735
ChromosomeChromosome/Scaffold: 017703189 Start: 19771 End: 24671
Descriptionglycosyl hydrolase family 35 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35683500
  IMINGKREIFLSGSIHYPRSTVDMWPDLLKKAKRGVLQWNFEGNADVVKFIRLVQENNMYVTLRVGPFIQAEWNHGGLPYWLREEPNIIFRSDNPAYKQH
  MEAYVTKIMKMMKDEKLFAPQGGPIILAQTHVQLAYKEXGTNYVQWAANMALAQNIGVPWIMCKQTNAPDPIINTCNGRHCGDTFAGPNKPHKPSLWTEN
  WTAQYRVFGDPPSQRSAEDIAFSVARFFSKDGTLTNYYMYHGGTNFGRTSAIFTTTRYYDEAPLDEYGLQREPKWSHLRDLHK
Full Sequence
Protein Sequence     Length: 915     Download
MVVAKRVLLI SFVLLVVSPS LCYAKGNKAA PAADGETVED TVEGEEPVVG KSEKKLEVGQ    60
VTYDGRSIMI NGKREIFLSG SIHYPRSTVD MWPDLLKKAK RGVLQWNFEG NADVVKFIRL    120
VQENNMYVTL RVGPFIQAEW NHGGLPYWLR EEPNIIFRSD NPAYKQHMEA YVTKIMKMMK    180
DEKLFAPQGG PIILAQTHVQ LAYKEXGTNY VQWAANMALA QNIGVPWIMC KQTNAPDPII    240
NTCNGRHCGD TFAGPNKPHK PSLWTENWTA QYRVFGDPPS QRSAEDIAFS VARFFSKDGT    300
LTNYYMYHGG TNFGRTSAIF TTTRYYDEAP LDEYGLQREP KWSHLRDLHK ALNLCKKPLL    360
AGASGVARFY ERPGTDICVA FLANNHSKLE TSVTWRGQEY FLPPHSISIL PDCKTVVFNS    420
QQIVSQHNSR NFVRSKAANK LNWEMSPEPI PTVEQVPVNQ XKPQELYHLL KDATDYGWFT    480
TSLNLGPYDL PMKDSIRPVI RIPSLGHAMG VFVNGEYIGK STATVLHTLH PSILCQCQCQ    540
GSEHGSHEEK GFVFERPVTF KQGINHISLL CMTVGLPDSG AYMEHRYAGP RTINVLGLNT    600
GTIDLSQNGW GHRVGLNGEN LQVFTEKGAQ KVQWTKAVGK GRGLTWYKTY FDAPEGRDPV    660
AIRMTGMGKG MIWXNGLSIG RHWMSYLSPL GQPTQAEYHI PRSLIKPSKN FLVVLEEQGA    720
DPKDIEILTV NRDTICSMST QMHPPHVKAF ERKAGKFKVV AGVPGATAQL KCPNYKKIVA    780
VEFASFGSPE GACGTYAIGK CDAPGTKKIV EEVKSSLGIM QKCLGQTTCT VPSDPKLFFK    840
VDPCPDVKIK TLAIQTTSVC QKHSLSLVVK NAKLHTRKIL IYASLCTVSY HQQKENHSNF    900
STNKHNAIHR KDARA 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1874LacA1.0e-861179140+
pfam02140Gal_Lectin5.0e-1277085590+
pfam01301Glyco_hydro_351.0e-12167352322+
PLN03059PLN03059061860857+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAS76480.1018551839beta-galactosidase [Gossypium hirsutum]
GenBankACC60982.106185528823beta-galactosidase 2 precursor [Petunia x hybrida]
RefSeqXP_002278545.106185632827PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306183.106185531823predicted protein [Populus trichocarpa]
RefSeqXP_002312963.106185531822predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A7e-30523484325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D9e-246034810330A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D0.002609744503630A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C9e-246034810330A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778160720617270
HO7806025991086880
CO128575296903630
CO1211552841053750
BQ6410262462384710
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi3g42330.1Bradi4g36517.1Bradi2g24670.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_64.120evm.model.supercontig_37.144
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I02332.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna06055.1-v1.0-hybridmrna07651.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma04g38580.3Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2
Glyma08g00470.2Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2
Glyma12g03650.1Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052200.1Gorai.010G052300.1Gorai.009G265200.1Gorai.002G197200.3
Gorai.002G197200.2Gorai.002G197200.1Gorai.002G197100.1Gorai.008G036000.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000322037MDP0000320504
MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00038026mPavirv00010484m
Phaseolus vulgarisPhvul.009G153000.1Phvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1
Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10024392mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)