CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000211550
FamilyAA7
Protein PropertiesLength: 844 Molecular Weight: 95587.9 Isoelectric Point: 8.9277
ChromosomeChromosome/Scaffold: 017731267 Start: 6652 End: 12684
Descriptioncytokinin oxidase 4
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA7602526.6e-27
  VYEFAAAVLNPTSPNDIVSLILSANNNSAPVSVAARGQGHSVRGQALTSGGVVINMTALIRNGSRIVVSESPSLGSYADVGGEQRWIDVLRATLERGLTP
  VSWTDYLYLSVGGTLSNAGISGQTFLYGPQINNVYELDVVTGKGELVTCSSKKVPELFYAVLGGLGQFGIITRARIPLAPAPKRAKWVRMMYS
Full Sequence
Protein Sequence     Length: 844     Download
MAENFAVPKY WTTLSLVLGF MMLSATGTSL LLPSLGDIES LLLNDTGSIN STSTDYGHIV    60
YEFAAAVLNP TSPNDIVSLI LSANNNSAPV SVAARGQGHS VRGQALTSGG VVINMTALIR    120
NGSRIVVSES PSLGSYADVG GEQRWIDVLR ATLERGLTPV SWTDYLYLSV GGTLSNAGIS    180
GQTFLYGPQI NNVYELDVVT GKGELVTCSS KKVPELFYAV LGGLGQFGII TRARIPLAPA    240
PKRAKWVRMM YSNFSAFSRD QEHLMAPNGF DYLEGFLLMK QGPLDLSFYP LLDQPRIAAL    300
INRYGIIYYI EAAKYYDDST TKTVDKVVEK TIKGLSFVPE FLFEQDVSYI DFLDRVHTEE    360
ENLRSLGLWE IAHPWLNIFV PKSRISDIDS GVFRNILLKQ NVPTAVSXIY PMNRKRWDGR    420
MSAVIPDEDV FYVVGLLHAS GFNDWQAFDE VNRQLLQFCT DAGIRVKQYL PHYKTREDWK    480
NHFGRKWQSF QDMKVRVSPH VGEDQSLEPS RTPFGRQALP XMVALFTTSV GNPLPXSRNA    540
ILGTTRRQQL SFSRLFSVQI ENPNHITNNL QRSCQFSCGD ILYEHPLQLP TTNANFFCRT    600
GVRIGYGVFA AVKEAKMVLT EEEITRLYRV RKTVMQMLKD RNYLVGDFEI NMSKEQFKDK    660
YGENMKREDL IINKTKRTDT NDQIYVFFPD EPKVGVKTMK TYTNRMKSEN VFRAILVTQQ    720
SLTPFAKTCI SEISGKFHLE VFALTSALEE SYFYPTYKKL APPIIEAELL VNIKEHVLVP    780
EHRVLTNEEK KTLLERYTVK ETQLPRIQVT DPIAKYYGLK RAQVVKIIRP SETAGRYVTY    840
RYVI                                                                 900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01191RNA_pol_Rpb5_C6.0e-4077184474+
PTZ00061PTZ000613.0e-74621844226+
pfam09265Cytokin-bind4.0e-108241500271+
PLN03111PLN031112.0e-120617844228+
PLN02441PLN02441024499485+
Gene Ontology
GO TermDescription
GO:0003677DNA binding
GO:0003899DNA-directed RNA polymerase activity
GO:0005634nucleus
GO:0006351transcription, DNA-dependent
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN80714.103750141510hypothetical protein [Vitis vinifera]
RefSeqXP_002263754.103750141510PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002279519.1014991507PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308300.102449927515cytokinin oxidase [Populus trichocarpa]
RefSeqXP_002514119.1014991517gulonolactone oxidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s1e_A03849925504A Chain A, Pro427gln Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenine
PDB3s1c_A03849925504A Chain A, Pro427gln Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenine
PDB3dq0_A03849925504A Chain A, Pro427gln Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenine
PDB3c0p_A03849925504A Chain A, Pro427gln Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenine
PDB3bw7_A03849925504A Chain A, Pro427gln Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenine
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO5229032316078370
CN5788712305457740
CV8828232075437490
BU8304482296168440
CK3186652296168440
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01436.1Aquca_002_01436.2Aquca_014_00736.1Aquca_007_00318.1Aquca_009_00356.1
Aquca_010_00588.1
Arabidopsis lyrata483228489034867825476695857642
918856480522
Arabidopsis thalianaAT2G41510.1AT5G21482.1AT3G63440.1AT1G75450.1AT1G75450.2
AT4G29740.2AT4G29740.1AT5G56970.1AT2G19500.1
Brachypodium distachyonBradi3g29130.2Bradi3g29130.1Bradi2g27170.1Bradi2g60456.1Bradi2g05580.1
Bradi3g08230.1Bradi2g06030.1Bradi1g37470.1Bradi3g08220.1Bradi3g37690.1
Bradi2g51530.1
Brassica rapaBra016928Bra020157Bra002371Bra007743Bra000229
Bra004626Bra015842Bra040677Bra002777Bra036719
Bra035640Bra024135
Carica papayaevm.model.supercontig_182.26evm.model.supercontig_2087.1evm.model.supercontig_126.29
Capsella rubellaCarubv10022823mCarubv10018610mCarubv10000702mCarubv10026233mCarubv10013466m
Carubv10023000mCarubv10020114m
Chlamydomonas reinhardtiig9859.t1
Citrus clementinaCiclev10006491mCiclev10008441mCiclev10007999mCiclev10000709mCiclev10007992m
Ciclev10031210m
Citrus sinensisorange1.1g009956morange1.1g016403morange1.1g008291morange1.1g042782morange1.1g009793m
orange1.1g022399m
Cucumis sativusCucsa.018150.1Cucsa.231890.1Cucsa.155270.1Cucsa.299790.2Cucsa.299790.1
Cucsa.166070.1Cucsa.117040.1Cucsa.155280.1
Eucalyptus grandisEucgr.F01857.1Eucgr.G03270.1Eucgr.K01574.1Eucgr.C03157.1Eucgr.C00881.1
Eucgr.H03195.1Eucgr.C00883.1Eucgr.H03393.1Eucgr.H03190.1Eucgr.H03197.1
Fragaria vescamrna21961.1-v1.0-hybridmrna15204.1-v1.0-hybridmrna30442.1-v1.0-hybridmrna14452.1-v1.0-hybridmrna15382.1-v1.0-hybrid
mrna30654.1-v1.0-hybridmrna12649.1-v1.0-hybridmrna12648.1-v1.0-hybrid
Glycine maxGlyma09g07190.4Glyma09g07190.3Glyma09g07190.2Glyma09g07190.1Glyma14g11280.1
Glyma03g28910.2Glyma12g01390.2Glyma12g01390.1Glyma19g31620.1Glyma09g35950.1
Glyma13g16430.1Glyma11g20860.1Glyma17g06220.1Glyma17g06230.1Glyma13g16420.2
Glyma09g07360.1Glyma06g03180.1Glyma15g18560.1Glyma04g03130.1Glyma06g03180.2
Glyma17g34330.1
Gossypium raimondiiGorai.011G295400.1Gorai.012G081000.1Gorai.009G198300.4Gorai.009G198300.3Gorai.009G198300.2
Gorai.009G198300.1Gorai.013G014800.1Gorai.010G083400.1Gorai.006G134800.1Gorai.004G286300.1
Gorai.009G040700.4Gorai.009G040700.3Gorai.009G040700.2Gorai.009G040700.1Gorai.010G096700.3
Gorai.010G096700.2Gorai.010G096700.1Gorai.013G227400.1Gorai.001G012300.1Gorai.010G007500.1
Gorai.002G126300.1Gorai.013G221000.1
Linum usitatissimumLus10035433Lus10031046Lus10039574Lus10005317Lus10026471
Lus10018039Lus10016363Lus10024289Lus10003845Lus10027611
Lus10031765Lus10031188Lus10031200
Malus domesticaMDP0000223673MDP0000318353MDP0000293966MDP0000256199MDP0000250917
MDP0000238100MDP0000271354MDP0000312902MDP0000213431MDP0000279125
Manihot esculentacassava4.1_033022mcassava4.1_029100mcassava4.1_004923mcassava4.1_005650mcassava4.1_008801m
cassava4.1_005737mcassava4.1_033151m
Medicago truncatulaMedtr1g015410.1Medtr7g090920.1Medtr3g036100.1Medtr4g044110.1Medtr2g039410.1
Mimulus guttatusmgv1a004484mmgv1a022053mmgv1a004444mmgv1a004144mmgv1a004294m
Oryza sativaLOC_Os08g35860.1LOC_Os05g31040.1LOC_Os10g34230.1LOC_Os01g71310.1LOC_Os04g44230.1
LOC_Os01g09260.1LOC_Os02g12780.1LOC_Os01g10110.1LOC_Os06g37500.1LOC_Os01g56810.1
Panicum virgatumPavirv00052903mPavirv00063358mPavirv00060424mPavirv00044659mPavirv00018118m
Pavirv00028994mPavirv00031945mPavirv00035115mPavirv00059528mPavirv00068235m
Pavirv00015211mPavirv00010010mPavirv00027542mPavirv00001793m
Physcomitrella patensPp1s403_31V6.1Pp1s595_6V6.1Pp1s222_49V6.1Pp1s152_115V6.1
Phaseolus vulgarisPhvul.001G038800.1Phvul.001G128800.1Phvul.011G014000.1Phvul.005G034000.1Phvul.009G060200.1
Phvul.003G136400.1Phvul.003G136500.1Phvul.009G081800.1Phvul.009G231700.1Phvul.009G231800.1
Picea abiesMA_173695g0010MA_31778g0010MA_113618g0010MA_42031g0010MA_17212g0010
MA_138486g0010MA_32541g0010MA_23320g0010MA_10433485g0010MA_5215129g0010
MA_197101g0010
Populus trichocarpaPotri.016G044100.1Potri.006G047900.1Potri.001G020900.1Potri.003G203600.1Potri.005G232300.1
Potri.002G030500.1Potri.006G152500.1Potri.006G221000.1Potri.007G066100.1
Prunus persicappa024442mppa004120mppa003895mppb021417mppa004276m
ppa021859m
Ricinus communis29912.m00533430131.m00725529614.m00004030170.m01410329739.m003615
30169.m006344
Setaria italicaSi001018mSi021761mSi035175mSi000960mSi012051m
Si019278mSi008391mSi013710mSi013569m
Selaginella moellendorffii17472198722
Sorghum bicolorSb07g022530.1Sb09g018640.1Sb03g045410.1Sb01g019000.1Sb03g003280.1
Sb03g002810.1Sb04g007740.1Sb04g007730.1Sb06g022930.1Sb10g022590.1
Thellungiella halophilaThhalv10013259mThhalv10016470mThhalv10005878mThhalv10018378mThhalv10013271m
Thhalv10024918mThhalv10023158m
Vitis viniferaGSVIVT01001461001GSVIVT01005041001GSVIVT01009786001GSVIVT01015194001GSVIVT01028599001
GSVIVT01028610001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)