y
Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000211642 |
Family | GT35 |
Protein Properties | Length: 166 Molecular Weight: 18480.7 Isoelectric Point: 5.3106 |
Chromosome | Chromosome/Scaffold: 01611155 Start: 2932 End: 3983 |
Description | alpha-glucan phosphorylase 2 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT35 | 1 | 166 | 0 |
MEASGTSNMKFALNGCLIIGTLDGANVEIREEIGDDNFFLFGATADEVPKLRKDRENGLINASSMKALHSMFVKFKPDPRFEEAKQFVRSGAFGSYDYNP LLDSLEGNTGYGRGDYFLVGHDFAQYVDAQAKVDEAYKDRKRWLKMSILSTAGSGKFSSDRTIAQY |
Full Sequence |
---|
Protein Sequence Length: 166 Download |
MEASGTSNMK FALNGCLIIG TLDGANVEIR EEIGDDNFFL FGATADEVPK LRKDRENGLI 60 NASSMKALHS MFVKFKPDPR FEEAKQFVRS GAFGSYDYNP LLDSLEGNTG YGRGDYFLVG 120 HDFAQYVDAQ AKVDEAYKDR KRWLKMSILS TAGSGKFSSD RTIAQY 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PRK14985 | PRK14985 | 4.0e-44 | 2 | 166 | 168 | + maltodextrin phosphorylase; Provisional | ||
COG0058 | GlgP | 9.0e-47 | 1 | 166 | 168 | + Glucan phosphorylase [Carbohydrate transport and metabolism] | ||
TIGR02093 | P_ylase | 2.0e-69 | 1 | 166 | 171 | + glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
pfam00343 | Phosphorylase | 3.0e-70 | 1 | 166 | 171 | + Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin. | ||
cd04300 | GT1_Glycogen_Phosphorylase | 1.0e-70 | 1 | 166 | 169 | + This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004645 | phosphorylase activity |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABR26152.1 | 0 | 1 | 166 | 46 | 196 | alpha-glucan phosphorylase, h isozyme [Oryza sativa Indica Group] |
Swiss-Prot | P32811 | 0 | 1 | 166 | 675 | 825 | PHSH_SOLTU RecName: Full=Alpha-glucan phosphorylase, H isozyme; AltName: Full=Starch phosphorylase H |
RefSeq | XP_002280732.1 | 0 | 1 | 166 | 680 | 830 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002313399.1 | 0 | 1 | 166 | 690 | 840 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002520435.1 | 0 | 1 | 166 | 686 | 836 | glycogen phosphorylase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1ygp_B | 3e-30 | 2 | 166 | 720 | 868 | A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. |
PDB | 1ygp_A | 3e-30 | 2 | 166 | 720 | 868 | A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. |
PDB | 1qm5_B | 2e-28 | 2 | 166 | 637 | 787 | A Chain A, Phosphorylase Recognition And Phosphorylysis Of Its Oligosaccharide Substrate: Answers To A Long Outstanding Question |
PDB | 1qm5_A | 2e-28 | 2 | 166 | 637 | 787 | A Chain A, Phosphorylase Recognition And Phosphorylysis Of Its Oligosaccharide Substrate: Answers To A Long Outstanding Question |
PDB | 1e4o_B | 2e-28 | 2 | 166 | 637 | 787 | A Chain A, Phosphorylase Recognition And Phosphorylysis Of Its Oligosaccharide Substrate: Answers To A Long Outstanding Question |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EE488135 | 166 | 1 | 166 | 0 |
GO531407 | 166 | 1 | 166 | 0 |
CN878674 | 166 | 1 | 166 | 0 |
EB145169 | 160 | 7 | 166 | 0 |
EB145221 | 160 | 7 | 166 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|