| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000224162 |
| Family | GH17 |
| Protein Properties | Length: 123 Molecular Weight: 13478.7 Isoelectric Point: 5.8364 |
| Chromosome | Chromosome/Scaffold: 021996184 Start: 608 End: 979 |
| Description | O-Glycosyl hydrolases family 17 protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 26 | 114 | 1.8e-26 |
| LGVNWGTMATHELPPDTVIQILKDNGIPKVKLFDADESTMSALTGSGLEVMVAIPNDQLAVMTSYKRAKEWVRRNVTRYNFNGGVNIKY | |||
| Full Sequence |
|---|
| Protein Sequence Length: 123 Download |
| MERMMWVLVG VAVLCVYGGG GGVEGLGVNW GTMATHELPP DTVIQILKDN GIPKVKLFDA 60 DESTMSALTG SGLEVMVAIP NDQLAVMTSY KRAKEWVRRN VTRYNFNGGV NIKYDFNLLS 120 ILL |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00925 | GTP_cyclohydro2 | 0.003 | 45 | 80 | 36 | + GTP cyclohydrolase II. GTP cyclohydrolase II catalyzes the first committed step in the biosynthesis of riboflavin. | ||
| pfam00332 | Glyco_hydro_17 | 7.0e-13 | 39 | 114 | 77 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABN09816.1 | 8.96831e-44 | 4 | 114 | 9 | 114 | Glycoside hydrolase, family 17; X8 [Medicago truncatula] |
| RefSeq | NP_176656.1 | 7.9874e-44 | 27 | 114 | 26 | 113 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
| RefSeq | NP_179534.1 | 2.94273e-44 | 23 | 114 | 18 | 109 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
| RefSeq | XP_002277003.1 | 0 | 1 | 114 | 1 | 113 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002525445.1 | 6.02558e-44 | 15 | 114 | 19 | 111 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 0.0000000007 | 26 | 104 | 1 | 80 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_D | 0.000000002 | 26 | 101 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_C | 0.000000002 | 26 | 101 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_B | 0.000000002 | 26 | 101 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_A | 0.000000002 | 26 | 101 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| Transmembrane Domains | ||||
|---|---|---|---|---|
 | ||||
| Start | End | |||
| 4 | 26 | |||
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 22 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EB127604 | 114 | 1 | 114 | 0 |
| EB141975 | 114 | 1 | 114 | 0 |
| EB142058 | 114 | 1 | 114 | 0 |
| CV628771 | 83 | 32 | 114 | 0 |
| EB138190 | 114 | 1 | 114 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |