CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000234849
FamilyGT1
Protein PropertiesLength: 405 Molecular Weight: 44566.6 Isoelectric Point: 5.2714
ChromosomeChromosome/Scaffold: 019350180 Start: 1384 End: 2601
DescriptionUDP-glucosyl transferase 89B1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11833709.1e-33
  SAVSLEHIKLWLDACAEDHKVVYVCFGSQAVLTNHQMEAVASGLEKSGVRFVWSVKGPTKGHVVGDYGAVPAGFENRTAGRGLVIRGWAPQVFILSHRAV
  GSFLTHCGWNSVLESVVAGVPMLAWPGGADQFCNATLIVDQLKVGVRVCEGARTVPDSDELARVLAESVSGDWAERARAAGLREAARE
Full Sequence
Protein Sequence     Length: 405     Download
MMCALGQLHD PLLRWFTSHP NPPVAIISDM FLGWTHHLAT QLGIQRLMFS ASGAFAISIV    60
DALWERMPKR DDPEDQDQVF AFPQVPNSPK YPWWQLSTVY RSYVEGNPDS EFIRDGYKSN    120
MASWGLVVNS FTELERVYLE HLKEELGYDR VWAVGPLLPP DRVNDDVDKD DESRPTKIRG    180
GSSAVSLEHI KLWLDACAED HKVVYVCFGS QAVLTNHQME AVASGLEKSG VRFVWSVKGP    240
TKGHVVGDYG AVPAGFENRT AGRGLVIRGW APQVFILSHR AVGSFLTHCG WNSVLESVVA    300
GVPMLAWPGG ADQFCNATLI VDQLKVGVRV CEGARTVPDS DELARVLAES VSGDWAERAR    360
AAGLREAARE AIKEGGTSVN ELDRLVCQLC ALEIPASSNL QSVPN 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02167PLN021675.0e-42125354239+
PLN03004PLN030043.0e-45123351231+
PLN02534PLN025345.0e-594330328+
PLN03007PLN030075.0e-6023389383+
PLN02863PLN0286301394394+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM12962.10139274444putative glucosyltransferase [Arabidopsis thaliana]
GenBankAAR06921.10139094467UDP-glycosyltransferase 89B2 [Stevia rebaudiana]
RefSeqXP_002273331.10139493478PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318584.10139289465predicted protein [Populus trichocarpa]
RefSeqXP_002514595.10139693471UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A7e-38125382209460A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB2vch_A7e-38125382209460A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB2vce_A7e-38125382209460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acw_B6e-3721386113458A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acw_A6e-3721386113458A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG63125640514050
FG645907303333350
CV226548263903520
EL480527294923840
GE60768724412440
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00233.1Aquca_006_00378.1Aquca_006_00376.1
Arabidopsis lyrata892083487125895254887793
Arabidopsis thalianaAT5G03490.1AT1G51210.1AT1G73880.1AT1G06000.1
Brachypodium distachyonBradi5g10710.1Bradi3g38930.1Bradi5g24280.1Bradi3g38937.1Bradi1g43600.1
Brassica rapaBra021887Bra014275Bra018901Bra003824
Carica papayaevm.model.supercontig_84.77evm.model.supercontig_3.220evm.model.supercontig_3.217
Capsella rubellaCarubv10012161mCarubv10023200mCarubv10019517m
Citrus clementinaCiclev10031430mCiclev10020006m
Citrus sinensisorange1.1g042753m
Cucumis sativusCucsa.149660.1
Eucalyptus grandisEucgr.B00651.1Eucgr.B00649.1Eucgr.B00652.1Eucgr.B00650.1Eucgr.B00655.1
Fragaria vescamrna04524.1-v1.0-hybridmrna04525.1-v1.0-hybridmrna26144.1-v1.0-hybrid
Glycine maxGlyma06g40390.1Glyma01g09160.1Glyma06g22820.1
Gossypium raimondiiGorai.012G185000.3Gorai.012G185000.2Gorai.012G185000.1Gorai.012G184900.1Gorai.008G174800.1
Gorai.012G185100.1Gorai.003G103500.1Gorai.006G228500.1Gorai.006G228600.1Gorai.006G228800.1
Linum usitatissimumLus10034650Lus10013500Lus10036840Lus10036837Lus10007972
Malus domesticaMDP0000452163MDP0000322436MDP0000221563
Manihot esculentacassava4.1_034323mcassava4.1_006835mcassava4.1_006752mcassava4.1_028099m
Medicago truncatulaMedtr2g059240.1
Mimulus guttatusmgv1a019609mmgv1a008307m
Oryza sativaLOC_Os06g17260.1LOC_Os08g38160.1LOC_Os04g55680.1LOC_Os08g38130.1LOC_Os08g38110.1
LOC_Os06g17120.1LOC_Os06g17140.1LOC_Os06g17250.1LOC_Os06g17020.1LOC_Os06g17110.1
Panicum virgatumPavirv00056484mPavirv00050341mPavirv00051468mPavirv00041386mPavirv00036251m
Pavirv00055583mPavirv00021505mPavirv00001223mPavirv00015738mPavirv00056972m
Phaseolus vulgarisPhvul.003G036900.1Phvul.011G151100.1Phvul.011G151200.1
Picea abiesMA_11273g0020MA_10434954g0010MA_9790207g0010MA_265454g0010MA_57964g0010
MA_705145g0010
Populus trichocarpaPotri.010G137000.1Potri.012G065100.1
Prunus persicappa024271mppa018626m
Ricinus communis30138.m00391130138.m00390930138.m00389030138.m003910
Setaria italicaSi019365mSi015554mSi009974mSi013651mSi015553m
Sorghum bicolorSb07g028920.1Sb06g030880.1Sb10g010340.1Sb06g030820.1Sb10g010343.1
Thellungiella halophilaThhalv10012395mThhalv10018506m
Vitis viniferaGSVIVT01008168001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)