Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000238176 |
Family | GH31 |
Protein Properties | Length: 111 Molecular Weight: 12453.3 Isoelectric Point: 7.04 |
Chromosome | Chromosome/Scaffold: 006236470 Start: 5914 End: 6249 |
Description | Glycosyl hydrolases family 31 protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH31 | 1 | 97 | 5.1e-29 |
EAAEKGLPVCRHLFLHYPDDEHVHNLTYQEFLIGTEILVVPVLDKGKNNVKAYFPRGETSCWEHIWSGKQYSKQGSEATVDAPIGCPAVFVKTGSIV |
Full Sequence |
---|
Protein Sequence Length: 111 Download |
EAAEKGLPVC RHLFLHYPDD EHVHNLTYQE FLIGTEILVV PVLDKGKNNV KAYFPRGETS 60 CWEHIWSGKQ YSKQGSEATV DAPIGCPAVF VKTGSIVGQT FLKNLRDLKI L 120 |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
PRK10658 | PRK10658 | 1.0e-8 | 1 | 71 | 71 | + putative alpha-glucosidase; Provisional |
COG1501 | COG1501 | 6.0e-22 | 1 | 97 | 97 | + Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism] |
pfam01055 | Glyco_hydro_31 | 1.0e-26 | 1 | 97 | 100 | + Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases. |
PRK10426 | PRK10426 | 4.0e-33 | 1 | 101 | 101 | + alpha-glucosidase; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI30134.1 | 0 | 1 | 111 | 795 | 905 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_001042693.1 | 9.80909e-45 | 1 | 111 | 268 | 390 | Os01g0268600 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002266626.1 | 0 | 1 | 111 | 761 | 871 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002308887.1 | 0 | 1 | 111 | 765 | 875 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002522166.1 | 0 | 1 | 111 | 764 | 874 | alpha-xylosidase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3w38_A | 0.0000000005 | 1 | 98 | 666 | 761 | A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide |
PDB | 3w37_A | 0.0000000005 | 1 | 98 | 666 | 761 | A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide |
PDB | 4kmq_A | 0.00000002 | 1 | 97 | 732 | 823 | A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide |
PDB | 3top_B | 0.0000003 | 1 | 97 | 674 | 766 | A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide |
PDB | 3top_A | 0.0000003 | 1 | 97 | 674 | 766 | A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CV049489 | 110 | 1 | 110 | 0 |
FC863767 | 111 | 1 | 111 | 0 |
FN749697 | 111 | 1 | 111 | 0 |
FR600285 | 111 | 1 | 111 | 0 |
CB303755 | 111 | 1 | 111 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |