CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000252988
FamilyAA1
Protein PropertiesLength: 741 Molecular Weight: 82501.8 Isoelectric Point: 8.478
ChromosomeChromosome/Scaffold: 015552419 Start: 5232 End: 8791
DescriptionLaccase/Diphenol oxidase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1355300
  RYTFVVEETPYKRLCSTKNILTVNGQFPGPTLYAHAGDIVVVDVYNKGNRNITIHWHGVKQPRNPWSDGPDYITQCPIQPGARFTQTIIFSSEEGTLWWH
  AHSEWDRATVHGAIVIYPKKGATYPFPKPHAEFPIILGEWWKEDIGQLYNETIQSGGDPNNSSAFLINGQPGDLYPCSKPDTFKLIVDYGKTYLLRLINS
  AVQEMMFFAIANHSVTVVGSDASYTKPFSTDYVTISPGQTIDLLLNADQSPNNYYIAAKAYVGGAGIAYDNTTTTAILRYHGNSNSSPTSLPNIPSHNNT
  NASVHFTSKLKSLADKKHPIDVPHKITTPLFFTLSINSLPCPNNSCAGPNGTRLATSINNISFVSPTIDILQAYYYHVNGAFGSRFPNSPPLLFNFTAQD
  LPLYLQTPKQGTEVKILEYNSTVEIVFQGTNLVAGDDHPMHLHGFSFYVVGWGLGNFDKDKDPLTYNLVDPPLQNTIAVPVNGWTTIRFKADNPGT
Full Sequence
Protein Sequence     Length: 741     Download
MSSSISMKIL ISLKLVVGLL LSTVGIFRCQ ASPPRYTFVV EETPYKRLCS TKNILTVNGQ    60
FPGPTLYAHA GDIVVVDVYN KGNRNITIHW HGVKQPRNPW SDGPDYITQC PIQPGARFTQ    120
TIIFSSEEGT LWWHAHSEWD RATVHGAIVI YPKKGATYPF PKPHAEFPII LGEWWKEDIG    180
QLYNETIQSG GDPNNSSAFL INGQPGDLYP CSKPDTFKLI VDYGKTYLLR LINSAVQEMM    240
FFAIANHSVT VVGSDASYTK PFSTDYVTIS PGQTIDLLLN ADQSPNNYYI AAKAYVGGAG    300
IAYDNTTTTA ILRYHGNSNS SPTSLPNIPS HNNTNASVHF TSKLKSLADK KHPIDVPHKI    360
TTPLFFTLSI NSLPCPNNSC AGPNGTRLAT SINNISFVSP TIDILQAYYY HVNGAFGSRF    420
PNSPPLLFNF TAQDLPLYLQ TPKQGTEVKI LEYNSTVEIV FQGTNLVAGD DHPMHLHGFS    480
FYVVGWGLGN FDKDKDPLTY NLVDPPLQNT IAVPVNGWTT IRFKADNPGT RLVYALSSGS    540
TYVMGHGHDV HSEKWKGPTS ADFTSATRNA SMLTIFIKLS TWFYVHGNNW DSMIMCAATQ    600
PPQFYCRFFH RRPFGTTQLD ATLCKLRNCS ELLSVSLVYK LCHNDPKDVI LFYGRNEMGC    660
YDSLIFWSVK RPTASPQLEA PAIRFQSYKH CSYLSTGLYR YIQGLGNQVF AAPMCSSGFI    720
TRDLDQPRRT KTRDIGHKTI S                                              780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02835PLN028358.0e-4836529503+
PLN02191PLN021918.0e-6431529533+
PLN02604PLN026049.0e-6929530529+
TIGR03388ascorbase3.0e-8149529514+
TIGR03389laccase035529495+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACC78283.102853523537putative laccase [Rosa hybrid cultivar]
EMBLCAN81469.104057354588hypothetical protein [Vitis vinifera]
RefSeqXP_002264394.1055343530PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002264702.1075341528PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002272618.1075351526PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0365306502A Chain A, Crystal Structure Of M37 Lipase
PDB1asq_A0365306502A Chain A, Crystal Structure Of M37 Lipase
PDB1asp_B0365306502A Chain A, Crystal Structure Of M37 Lipase
PDB1asp_A0365306502A Chain A, Crystal Structure Of M37 Lipase
PDB1aso_B0365306502A Chain A, Crystal Structure Of M37 Lipase
Signal Peptide
Cleavage Site
31
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO797675459785340
JK6210462741714370
CB974476260362950
JK514811262603210
GO515672190272160
Orthologous Group
SpeciesID
Arabidopsis lyrata917686487747
Arabidopsis thalianaAT5G48100.1AT5G09360.1
Brachypodium distachyonBradi3g59210.1Bradi3g59187.1
Brassica rapaBra020720Bra037510
Capsella rubellaCarubv10027828mCarubv10000589m
Citrus clementinaCiclev10003795m
Citrus sinensisorange1.1g036841m
Cucumis sativusCucsa.345760.1
Eucalyptus grandisEucgr.L01441.1Eucgr.J00889.1Eucgr.F02650.1Eucgr.H04936.1Eucgr.F04163.1
Eucgr.F02674.1Eucgr.H04937.1Eucgr.F02648.1Eucgr.F02642.1Eucgr.F02646.1
Eucgr.L00623.1Eucgr.B01273.1Eucgr.H02579.1Eucgr.F02649.1Eucgr.F04160.1
Eucgr.F04162.1Eucgr.F02641.1Eucgr.F04154.1Eucgr.L01656.1Eucgr.F02644.1
Eucgr.L00621.1Eucgr.C02745.1Eucgr.J00888.1Eucgr.F02652.2Eucgr.F02652.1
Eucgr.L01343.1Eucgr.L02310.1Eucgr.E04216.1Eucgr.G00841.1Eucgr.E04217.1
Eucgr.E04220.1Eucgr.E04219.1Eucgr.E04218.1Eucgr.E04221.1Eucgr.L01345.1
Eucgr.E03935.1Eucgr.F04158.1Eucgr.F02653.1Eucgr.E03932.1Eucgr.F04157.1
Eucgr.F02642.2Eucgr.F02649.2
Fragaria vescamrna16187.1-v1.0-hybridmrna27556.1-v1.0-hybridmrna27557.1-v1.0-hybridmrna27526.1-v1.0-hybridmrna27527.1-v1.0-hybrid
mrna27523.1-v1.0-hybridmrna15091.1-v1.0-hybridmrna27531.1-v1.0-hybridmrna24290.1-v1.0-hybridmrna27522.1-v1.0-hybrid
mrna17621.1-v1.0-hybridmrna11910.1-v1.0-hybridmrna24296.1-v1.0-hybridmrna05430.1-v1.0-hybridmrna24295.1-v1.0-hybrid
mrna02152.1-v1.0-hybridmrna24292.1-v1.0-hybridmrna08067.1-v1.0-hybridmrna11940.1-v1.0-hybrid
Glycine maxGlyma11g36058.1Glyma16g27480.1Glyma10g36320.1Glyma20g31280.1Glyma10g36310.1
Glyma20g31270.1
Gossypium raimondiiGorai.009G260400.1Gorai.009G260400.2Gorai.005G076600.2Gorai.005G076600.1Gorai.005G076600.3
Gorai.009G260600.1Gorai.009G261300.1Gorai.009G261000.1Gorai.009G260800.1Gorai.010G130100.1
Gorai.009G260400.3Gorai.009G261100.1Gorai.009G261500.1
Linum usitatissimumLus10041067Lus10026812Lus10036070Lus10041066
Malus domesticaMDP0000546342MDP0000143780MDP0000168293MDP0000318606MDP0000262848
MDP0000090732MDP0000242301MDP0000724206MDP0000419919MDP0000188477
MDP0000263468MDP0000148967
Manihot esculentacassava4.1_028126mcassava4.1_005540mcassava4.1_026478mcassava4.1_027769m
Medicago truncatulaMedtr3g101640.1.30.558Medtr3g101640.1.30.558Medtr2g008330.1
Mimulus guttatusmgv1a018195mmgv1a019066mmgv1a021399mmgv1a003690mmgv1a004060m
Oryza sativaLOC_Os02g51440.1LOC_Os11g47390.1
Panicum virgatumPavirv00068445mPavirv00039877mPavirv00029470mPavirv00044315mPavirv00029948m
Phaseolus vulgarisPhvul.004G086400.1Phvul.007G086400.1Phvul.007G086500.1Phvul.004G087000.1
Populus trichocarpaPotri.005G200600.1Potri.005G200500.1Potri.011G071100.1Potri.019G088900.1Potri.019G088500.1
Potri.019G088600.1Potri.019G088800.1Potri.019G088700.1Potri.019G088700.2Potri.005G200700.1
Potri.001G206200.1Potri.005G200500.2Potri.005G200600.2
Prunus persicappa016123mppa003529mppa003546mppa016865mppa015996m
ppa025323mppa003489mppa014804mppa003580mppa003663m
ppa003583mppa025087m
Ricinus communis28644.m00090929703.m00152429703.m00152729703.m00153128660.m000189
29703.m00153028644.m00094028644.m00093728644.m000938
Setaria italicaSi016752mSi007952mSi019864mSi019724m
Sorghum bicolorSb04g027860.1Sb04g034620.1Sb04g034610.1Sb04g027850.1Sb10g030340.1
Sb05g022480.1
Thellungiella halophilaThhalv10003921mThhalv10015612m
Vitis viniferaGSVIVT01001603001GSVIVT01012329001GSVIVT01013689001GSVIVT01013695001GSVIVT01013694001
GSVIVT01012332001GSVIVT01034783001GSVIVT01012343001GSVIVT01034842001GSVIVT01034817001
GSVIVT01001604001GSVIVT01001614001GSVIVT01012346001GSVIVT01013687001.321.754GSVIVT01013687001.321.754
GSVIVT01012359001GSVIVT01034828001GSVIVT01013692001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)