Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000254826 |
Family | AA2 |
Protein Properties | Length: 181 Molecular Weight: 19976.3 Isoelectric Point: 4.4398 |
Chromosome | Chromosome/Scaffold: 022133161 Start: 1888 End: 11544 |
Description | ascorbate peroxidase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 88 | 161 | 1.2e-24 |
SCRDNDRLAGVVAVEINGGPDVPFHPGRTDAPEPPPEGLLPDATKGNDHLRDVFCKTMGLSDKDIVALSGGHTL |
Full Sequence |
---|
Protein Sequence Length: 181 Download |
MECAILGRCT HQGTTISIPI FCHTTFSEVY NEVCSRPSNL THDLFDLTYA LPGYSTCLLQ 60 SDMDVWMLHM SVVNEKYYCV DIAINQKSCR DNDRLAGVVA VEINGGPDVP FHPGRTDAPE 120 PPPEGLLPDA TKGNDHLRDV FCKTMGLSDK DIVALSGGHT LDEDAFFXDY AESHMKLSEL 180 G |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02879 | PLN02879 | 0.0004 | 159 | 181 | 23 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 6.0e-7 | 162 | 181 | 20 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
PLN02879 | PLN02879 | 2.0e-31 | 94 | 161 | 68 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 2.0e-33 | 95 | 161 | 70 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
PLN02364 | PLN02364 | 4.0e-35 | 88 | 161 | 74 | + L-ascorbate peroxidase 1 |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1APX | 8e-33 | 63 | 161 | 73 | 164 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
GenBank | ABP87792.1 | 3e-34 | 88 | 161 | 92 | 165 | ascorbate peroxidase [Malus x domestica] |
GenBank | ABP87792.1 | 0.008 | 147 | 181 | 212 | 246 | ascorbate peroxidase [Malus x domestica] |
GenBank | ADC42881.1 | 7e-34 | 95 | 161 | 1 | 67 | ascorbate peroxidase [Malus pumila] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1apx_D | 1e-34 | 63 | 161 | 73 | 164 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_D | 0.002 | 147 | 181 | 211 | 245 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_C | 1e-34 | 63 | 161 | 73 | 164 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_C | 0.002 | 147 | 181 | 211 | 245 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_B | 1e-34 | 63 | 161 | 73 | 164 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CN858970 | 98 | 1 | 98 | 0 |
CN858974 | 96 | 1 | 96 | 0 |
EB126969 | 75 | 88 | 162 | 4e-36 |
EB145488 | 74 | 88 | 161 | 5e-36 |
GO528142 | 68 | 94 | 161 | 7e-36 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|