| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000269019 |
| Family | GH28 |
| Protein Properties | Length: 107 Molecular Weight: 11736.6 Isoelectric Point: 9.4674 |
| Chromosome | Chromosome/Scaffold: 000946134 Start: 866 End: 1189 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH28 | 13 | 95 | 4.8e-21 |
| EHLVFRRLTCISPDSATIALGSEMSGGIRDVRAEDITAIDTQSSVRIKTAVGRGAYVEDIYVRRITLKSMKYVFWMTGSYGSH | |||
| Full Sequence |
|---|
| Protein Sequence Length: 107 Download |
| MGKYGIKVGI PTEHLVFRRL TCISPDSATI ALGSEMSGGI RDVRAEDITA IDTQSSVRIK 60 TAVGRGAYVE DIYVRRITLK SMKYVFWMTG SYGSHPDPGF DPKALPL |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG5434 | PGU1 | 2.0e-8 | 2 | 80 | 79 | + Endopygalactorunase [Cell envelope biogenesis, outer membrane] | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004650 | polygalacturonase activity |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACU17976.1 | 0 | 3 | 106 | 272 | 375 | unknown [Glycine max] |
| RefSeq | NP_190464.1 | 0 | 3 | 106 | 265 | 368 | glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein [Arabidopsis thaliana] |
| RefSeq | XP_002273669.1 | 0 | 3 | 107 | 271 | 375 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002327490.1 | 0 | 3 | 106 | 251 | 354 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002513653.1 | 0 | 3 | 107 | 272 | 376 | polygalacturonase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3jur_D | 0.000000003 | 5 | 73 | 273 | 342 | A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima |
| PDB | 3jur_C | 0.000000003 | 5 | 73 | 273 | 342 | A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima |
| PDB | 3jur_B | 0.000000003 | 5 | 73 | 273 | 342 | A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima |
| PDB | 3jur_A | 0.000000003 | 5 | 73 | 273 | 342 | A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CN996871 | 104 | 3 | 106 | 0 |
| GO512791 | 104 | 3 | 106 | 0 |
| AJ821924 | 103 | 5 | 107 | 0 |
| BW595452 | 104 | 3 | 106 | 0 |
| JZ157041 | 105 | 3 | 107 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
