Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000269019 |
Family | GH28 |
Protein Properties | Length: 107 Molecular Weight: 11736.6 Isoelectric Point: 9.4674 |
Chromosome | Chromosome/Scaffold: 000946134 Start: 866 End: 1189 |
Description | Pectin lyase-like superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH28 | 13 | 95 | 4.8e-21 |
EHLVFRRLTCISPDSATIALGSEMSGGIRDVRAEDITAIDTQSSVRIKTAVGRGAYVEDIYVRRITLKSMKYVFWMTGSYGSH |
Full Sequence |
---|
Protein Sequence Length: 107 Download |
MGKYGIKVGI PTEHLVFRRL TCISPDSATI ALGSEMSGGI RDVRAEDITA IDTQSSVRIK 60 TAVGRGAYVE DIYVRRITLK SMKYVFWMTG SYGSHPDPGF DPKALPL |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
COG5434 | PGU1 | 2.0e-8 | 2 | 80 | 79 | + Endopygalactorunase [Cell envelope biogenesis, outer membrane] |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004650 | polygalacturonase activity |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACU17976.1 | 0 | 3 | 106 | 272 | 375 | unknown [Glycine max] |
RefSeq | NP_190464.1 | 0 | 3 | 106 | 265 | 368 | glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein [Arabidopsis thaliana] |
RefSeq | XP_002273669.1 | 0 | 3 | 107 | 271 | 375 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002327490.1 | 0 | 3 | 106 | 251 | 354 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002513653.1 | 0 | 3 | 107 | 272 | 376 | polygalacturonase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3jur_D | 0.000000003 | 5 | 73 | 273 | 342 | A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima |
PDB | 3jur_C | 0.000000003 | 5 | 73 | 273 | 342 | A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima |
PDB | 3jur_B | 0.000000003 | 5 | 73 | 273 | 342 | A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima |
PDB | 3jur_A | 0.000000003 | 5 | 73 | 273 | 342 | A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CN996871 | 104 | 3 | 106 | 0 |
GO512791 | 104 | 3 | 106 | 0 |
AJ821924 | 103 | 5 | 107 | 0 |
BW595452 | 104 | 3 | 106 | 0 |
JZ157041 | 105 | 3 | 107 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |