CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000300462
FamilyGH2
Protein PropertiesLength: 363 Molecular Weight: 41500.3 Isoelectric Point: 6.5116
ChromosomeChromosome/Scaffold: 015439174 Start: 307 End: 1970
Descriptionglycoside hydrolase family 2 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH223490
  GKQSLYKVSITVDVKGYGESDLWGQLFGFRKIHSYIDTVTGGRLFKVNGQPIFIRGGNWILSDGLLRLSKKRYKTDIKFHADMNFNMIRCWGGGLAERPD
  FYHYCDIYGLLVWQEFWITGDVDGRGIPVSNPDGPLDHDLFLLSARDTVKLLRNHPSLALWVGGNEQVPPDDINTALKNDLRLHPHFEKSVNESGKSTED
  LSPVLRDPSQYLDGMPVSATIRATMPPEGWQIPLFKKVSEYYEEVPNPIWEYHKYIPYSKPGKVHDQILLYGSQPKDLDDFCLKAQLVNYIQYRALLEGW
  TSRMWTKYTGVLIWKTQNPWTGFYGCRCAAEPIHVQLNLATYLIEVVN
Full Sequence
Protein Sequence     Length: 363     Download
MGKQSLYKVS ITVDVKGYGE SDLWGQLFGF RKIHSYIDTV TGGRLFKVNG QPIFIRGGNW    60
ILSDGLLRLS KKRYKTDIKF HADMNFNMIR CWGGGLAERP DFYHYCDIYG LLVWQEFWIT    120
GDVDGRGIPV SNPDGPLDHD LFLLSARDTV KLLRNHPSLA LWVGGNEQVP PDDINTALKN    180
DLRLHPHFEK SVNESGKSTE DLSPVLRDPS QYLDGMPVSA TIRATMPPEG WQIPLFKKVS    240
EYYEEVPNPI WEYHKYIPYS KPGKVHDQIL LYGSQPKDLD DFCLKAQLVN YIQYRALLEG    300
WTSRMWTKYT GVLIWKTQNP WTGFYGCRCA AEPIHVQLNL ATYLIEVVNT TSEELSDIAI    360
EAS                                                                  420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02836Glyco_hydro_2_C0.000145167127+
PRK09525lacZ2.0e-529167159+
PRK10340ebgA4.0e-86167175+
COG3250LacZ6.0e-245167165+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK84953.201363109536putative beta-mannosidase [Gossypium hirsutum]
EMBLCAN82620.101363298725hypothetical protein [Vitis vinifera]
EMBLCBI36793.101363298725unnamed protein product [Vitis vinifera]
RefSeqXP_002284576.101363298725PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319539.101363298725predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vqu_B4e-1746167323437A Chain A, Structural And Biochemical Evidence For A Boat-Like Transition State In Beta-Mannosidases
PDB2vqu_A4e-1746167323437A Chain A, Structural And Biochemical Evidence For A Boat-Like Transition State In Beta-Mannosidases
PDB2je8_B4e-1746167325439A Chain A, Structure Of A Beta-Mannosidase From Bacteroides Thetaiotaomicron
PDB2je8_A4e-1746167325439A Chain A, Structure Of A Beta-Mannosidase From Bacteroides Thetaiotaomicron
PDB2wbk_B4e-1746167323437A Chain A, Structure Of The Michaelis Complex Of Beta-Mannosidase, Man2a, Provides Insight Into The Conformational Itinerary Of Mannoside Hydrolysis
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES793920339753460
GO87160033732850
EY88634821812180
DB94611121452180
CV09631121092180
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00437.1Aquca_017_00437.4Aquca_054_00086.1Aquca_017_00437.2Aquca_017_00437.5
Aquca_017_00437.3
Arabidopsis lyrata888134
Arabidopsis thalianaAT1G09010.1
Brachypodium distachyonBradi2g26600.1
Brassica rapaBra018587Bra030751
Carica papayaevm.model.supercontig_48.57
Capsella rubellaCarubv10008228m
Citrus clementinaCiclev10000150mCiclev10000160m
Citrus sinensisorange1.1g045314m
Cucumis sativusCucsa.182080.2Cucsa.182080.1
Eucalyptus grandisEucgr.H04490.2Eucgr.H04490.1Eucgr.H04490.3
Fragaria vescamrna22540.1-v1.0-hybrid
Glycine maxGlyma10g29550.1Glyma20g37760.1Glyma03g39810.1Glyma19g42370.1
Gossypium raimondiiGorai.013G124100.1Gorai.007G297200.2Gorai.007G297200.1Gorai.007G297200.3Gorai.007G297200.4
Linum usitatissimumLus10029917Lus10004484
Malus domesticaMDP0000144916MDP0000026514MDP0000210658
Manihot esculentacassava4.1_001014m
Medicago truncatulaMedtr7g113570.1Medtr1g082890.1
Mimulus guttatusmgv1a023381mmgv1a000882mmgv1a024358m
Oryza sativaLOC_Os05g32530.1
Panicum virgatumPavirv00050693mPavirv00063196mPavirv00063197m
Physcomitrella patensPp1s2985_1V6.1Pp1s99_248V6.1Pp1s114_165V6.1
Phaseolus vulgarisPhvul.007G180100.1Phvul.006G092100.1
Picea abiesMA_10427468g0010
Populus trichocarpaPotri.013G021200.4Potri.013G021200.3Potri.013G021200.1Potri.013G021200.2
Prunus persicappa000875mppa000882m
Ricinus communis30128.m008776
Setaria italicaSi021098m
Selaginella moellendorffii164536
Sorghum bicolorSb09g019350.1
Thellungiella halophilaThhalv10006730m
Vitis viniferaGSVIVT01000073001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny