CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000306738
FamilyGH1
Protein PropertiesLength: 993 Molecular Weight: 110974 Isoelectric Point: 7.6841
ChromosomeChromosome/Scaffold: 018230151 Start: 24146 End: 36236
Descriptionglucose-6-phosphate/phosphate translocator 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH15919840
  IQPYVTLTHYDIPQELEDRYGAWLSPQVQADFKHYANTCFKFFGDRVKYWATFNEPNVAVPNGYRLGTYPPARCSIPFGNCTSGDSEREPFIAAHNIILS
  HAAAVNVYRTKYQKIQGGSIGIVMNAPWFEPISNSLEDKLAAERAISFYMNWSRPFDFLATRHTTKTVQQCRFLDPIVLGRYPAEMQELLGADLPAFSKS
  DVEMLKKTGLDFIGLNHYTSCYSKDCMFSVCESGTGASRTEGYALRTFEKDGVFIGEPTTIDWLYVYPQGMEKIVTYVKERYNNTPMFITENDSYIIGVD
  LLGFGEIENSNSSSAELLHDVKRLEYMGSYLQALAKAMRKGADVRGYLVWSLLDNFEWTSGYTIRFGLYRVDYTTLKRTQRLSAAWYKQFISNH
Full Sequence
Protein Sequence     Length: 993     Download
MQISSVKLRT PAFTSPEFLS RRCLIKSHSL SLPNFHNAQK TAPSSSSSSL KPLHISSGDC    60
FALAGKTEKG SAVCNAYEAD QSRPLEINIE LPDQQEATQR LKIGLYFATW WALNVVFNIY    120
NKKVLNVFPY PWLTSTLSLA TGSLMMLVSW ATRIAETPKT DLDFWKTLLP VAVAHTIGHV    180
AATVSMAKVA VSFTHIIKSS EPAFSVLVSR FLLGETFPLP VYLSLFPIIG GCALAAVTEL    240
NFNMIGFMGA MISNLAFVFR NIFSKKGMKG KSVSGMNYYA CLSMLSLLIL IPFAIAVEGP    300
KMWAAGWNTA LAQIGPNFVW WVVAQSVFYH LYNQVSYMSL DQISPLTFSV GNTMKRISVI    360
VASIIIFHTP IQPINALGAA IAILGTFLYS QMMKRDKETA LPMDMKVCKN QSQGVRVWSA    420
ELHGHGFVEL VYGITSSILT VSSSPSKVMG NFSVLVQAVL TTVQILCFSI LKASCNSPIS    480
LEGNAASSSF PSDFLFGTAS SSYQYEGAYL NDGKALNNWD VFTHEPDRIS DGTNGDIAVD    540
QYHLYMNWDL HAWTDYTXIR EVIQEDLDLM NYLGVNSYRF SISWARVLPR IQPYVTLTHY    600
DIPQELEDRY GAWLSPQVQA DFKHYANTCF KFFGDRVKYW ATFNEPNVAV PNGYRLGTYP    660
PARCSIPFGN CTSGDSEREP FIAAHNIILS HAAAVNVYRT KYQKIQGGSI GIVMNAPWFE    720
PISNSLEDKL AAERAISFYM NWSRPFDFLA TRHTTKTVQQ CRFLDPIVLG RYPAEMQELL    780
GADLPAFSKS DVEMLKKTGL DFIGLNHYTS CYSKDCMFSV CESGTGASRT EGYALRTFEK    840
DGVFIGEPTT IDWLYVYPQG MEKIVTYVKE RYNNTPMFIT ENDSYIIGVD LLGFGEIENS    900
NSSSAELLHD VKRLEYMGSY LQALAKAMRK GADVRGYLVW SLLDNFEWTS GYTIRFGLYR    960
VDYTTLKRTQ RLSAAWYKQF ISNHTVQASS TSS 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02849PLN028491.0e-108465985549+
TIGR00817tpt5.0e-113101400302+
COG2723BglB1.0e-120488983529+
TIGR03356BGL3.0e-129491977512+
pfam00232Glyco_hydro_16.0e-146489984529+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0016020membrane
GO:0055085transmembrane transport
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI23186.1045598221517unnamed protein product [Vitis vinifera]
RefSeqXP_002266056.1033912390PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305594.104659895502predicted protein [Populus trichocarpa]
RefSeqXP_002305597.1048098928513predicted protein [Populus trichocarpa]
RefSeqXP_002518516.1048798931509beta-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A048398210487A Chain A, Crystal Structure Of Galactose Oxidase Mutant W290f
PDB3gnp_A048398210487A Chain A, Crystal Structure Of Galactose Oxidase Mutant W290f
PDB3gno_A048398210487A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_B048998133503A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_A048998133503A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Transmembrane Domains
StartEnd
103120
130152
207229
244263
275297
302324
364386
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DC89520039433910
JG216592309533610
EX098901265763400
FE683020267933590
DW493296291593460
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_012_00117.1Aquca_054_00059.1Aquca_054_00064.2Aquca_054_00061.2Aquca_054_00061.1
Aquca_054_00064.3Aquca_054_00064.1.216.582Aquca_054_00064.1.216.582Aquca_054_00060.1Aquca_054_00064.4
Aquca_054_00061.3Aquca_054_00061.4Aquca_054_00061.5Aquca_054_00061.6
Arabidopsis lyrata475147492699475148
Arabidopsis thalianaAT1G61820.1AT4G21760.1AT1G61810.1AT1G61810.3AT1G61820.3
Brachypodium distachyonBradi5g15540.1Bradi5g15527.1Bradi5g15540.3Bradi5g15540.2
Brassica rapaBra028383Bra031392Bra038756Bra013557Bra038755
Carica papayaevm.model.supercontig_198.21
Capsella rubellaCarubv10021428mCarubv10020143mCarubv10021331mCarubv10006876m
Citrus clementinaCiclev10007996mCiclev10014887mCiclev10017801m
Citrus sinensisorange1.1g009535morange1.1g014339morange1.1g045534morange1.1g016308morange1.1g012716m
orange1.1g016444morange1.1g016438morange1.1g022079m
Cucumis sativusCucsa.341820.2Cucsa.341820.1Cucsa.123340.1Cucsa.086000.1Cucsa.341820.3
Cucsa.341810.1
Eucalyptus grandisEucgr.H00071.1Eucgr.H02855.1Eucgr.E04103.1Eucgr.H02856.1Eucgr.H02856.2
Fragaria vescamrna19575.1-v1.0-hybrid
Glycine maxGlyma15g11290.2Glyma13g35430.2Glyma12g35125.1Glyma07g38840.1Glyma07g38850.1
Glyma12g35140.2Glyma13g35410.2Glyma13g35410.3Glyma13g35410.4
Gossypium raimondiiGorai.010G178500.1Gorai.010G178800.1Gorai.013G167400.1Gorai.013G167400.2Gorai.013G167400.4
Gorai.011G016100.1.462.724Gorai.011G016100.1.462.724Gorai.013G167400.5Gorai.013G167400.3.150.447Gorai.013G167400.3.150.447
Gorai.013G167400.6
Linum usitatissimumLus10018353Lus10007656Lus10007655Lus10032660Lus10018354
Lus10032659
Malus domesticaMDP0000140817MDP0000213598MDP0000149337
Manihot esculentacassava4.1_005677mcassava4.1_032622mcassava4.1_031147mcassava4.1_026351m
Medicago truncatulaMedtr4g131800.1Medtr4g131810.1
Mimulus guttatusmgv1a004080m
Oryza sativaLOC_Os04g43360.1LOC_Os04g43410.1LOC_Os04g43390.2LOC_Os04g43360.2LOC_Os04g43390.1
LOC_Os04g43400.1LOC_Os04g43380.1
Panicum virgatumPavirv00042435mPavirv00070823mPavirv00006566mPavirv00021804mPavirv00059033m
Pavirv00006565mPavirv00036311mPavirv00010790m
Physcomitrella patensPp1s22_312V6.2Pp1s22_312V6.1
Phaseolus vulgarisPhvul.005G082900.1Phvul.005G082800.3Phvul.005G082800.2Phvul.005G082800.1Phvul.007G273800.1
Phvul.003G076700.1Phvul.006G151300.1Phvul.003G076800.1Phvul.006G151400.1Phvul.003G076700.2
Picea abiesMA_10431526g0010MA_119280g0010
Populus trichocarpaPotri.004G019800.1Potri.004G019700.1Potri.004G019500.1Potri.004G019300.1Potri.004G019300.2
Potri.001G403900.1Potri.004G019400.1
Prunus persicappa004523mppa025660mppa005194mppa017816m
Ricinus communis29842.m00362929904.m002964
Setaria italicaSi009837mSi009886mSi009882mSi009894mSi009871m
Si009850mSi010127mSi010115mSi010284mSi010346m
Si010332mSi010833m
Sorghum bicolorSb06g022460.1Sb06g022450.1Sb06g022510.1Sb06g022500.1Sb06g022410.1
Sb06g022490.1Sb06g022420.1Sb06g022385.1
Thellungiella halophilaThhalv10024134mThhalv10024920mThhalv10024911mThhalv10023411mThhalv10024896m
Vitis viniferaGSVIVT01014400001GSVIVT01012650001GSVIVT01014399001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)