Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000310215 |
Family | GH1 |
Protein Properties | Length: 137 Molecular Weight: 16079.5 Isoelectric Point: 8.708 |
Chromosome | Chromosome/Scaffold: 02078092 Start: 9709 End: 10272 |
Description | beta glucosidase 11 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH1 | 4 | 99 | 9.9e-24 |
KQHGYIGINVFAYWFVPLTKLIEDELATQRAIDFYFGWVLNPLVFGDYPDVMKKIVGSRIPVFTSLESRSVRGSFDFIGLNYYHPLNIKDYSSTLK |
Full Sequence |
---|
Protein Sequence Length: 137 Download |
MQDKQHGYIG INVFAYWFVP LTKLIEDELA TQRAIDFYFG WVLNPLVFGD YPDVMKKIVG 60 SRIPVFTSLE SRSVRGSFDF IGLNYYHPLN IKDYSSTLKM ETRDFMADSA IKISRKFFSY 120 TYTYVVKFFL HDVHSLV |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
TIGR03356 | BGL | 2.0e-8 | 9 | 93 | 85 | + beta-galactosidase. | ||
pfam00232 | Glyco_hydro_1 | 8.0e-15 | 5 | 94 | 93 | + Glycosyl hydrolase family 1. | ||
PLN02998 | PLN02998 | 9.0e-29 | 16 | 114 | 99 | + beta-glucosidase | ||
PLN02814 | PLN02814 | 5.0e-29 | 2 | 86 | 85 | + beta-glucosidase | ||
PLN02849 | PLN02849 | 6.0e-31 | 2 | 93 | 92 | + beta-glucosidase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN81257.1 | 3.00004e-41 | 2 | 116 | 189 | 303 | hypothetical protein [Vitis vinifera] |
EMBL | CBI36851.1 | 7e-40 | 2 | 113 | 292 | 403 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002267643.1 | 8.99999e-40 | 2 | 113 | 411 | 522 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002268258.1 | 2e-39 | 1 | 108 | 297 | 404 | PREDICTED: hypothetical protein isoform 3 [Vitis vinifera] |
RefSeq | XP_002523075.1 | 9.94922e-44 | 2 | 123 | 247 | 368 | beta-glucosidase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3ptq_B | 9e-25 | 2 | 86 | 257 | 341 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
PDB | 3ptq_A | 9e-25 | 2 | 86 | 257 | 341 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
PDB | 3ptm_B | 9e-25 | 2 | 86 | 257 | 341 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
PDB | 3ptm_A | 9e-25 | 2 | 86 | 257 | 341 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
PDB | 3ptk_B | 9e-25 | 2 | 86 | 257 | 341 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DR993247 | 113 | 2 | 114 | 0 |
CO417080 | 113 | 2 | 114 | 0 |
CX025372 | 110 | 2 | 111 | 0 |
FN732083 | 113 | 2 | 114 | 0 |
CU657655 | 113 | 2 | 114 | 1.4013e-45 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Aquilegia coerulea | Aquca_003_00737.1 | ||||
Brassica rapa | Bra006217 | Bra020858 | |||
Medicago truncatula | Medtr8g038650.1 | ||||
Prunus persica | ppb019447m |
Sequence Alignments (This image is cropped. Click for full image.) |
---|