| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000310215 |
| Family | GH1 |
| Protein Properties | Length: 137 Molecular Weight: 16079.5 Isoelectric Point: 8.708 |
| Chromosome | Chromosome/Scaffold: 02078092 Start: 9709 End: 10272 |
| Description | beta glucosidase 11 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 4 | 99 | 9.9e-24 |
| KQHGYIGINVFAYWFVPLTKLIEDELATQRAIDFYFGWVLNPLVFGDYPDVMKKIVGSRIPVFTSLESRSVRGSFDFIGLNYYHPLNIKDYSSTLK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 137 Download |
| MQDKQHGYIG INVFAYWFVP LTKLIEDELA TQRAIDFYFG WVLNPLVFGD YPDVMKKIVG 60 SRIPVFTSLE SRSVRGSFDF IGLNYYHPLN IKDYSSTLKM ETRDFMADSA IKISRKFFSY 120 TYTYVVKFFL HDVHSLV |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR03356 | BGL | 2.0e-8 | 9 | 93 | 85 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 8.0e-15 | 5 | 94 | 93 | + Glycosyl hydrolase family 1. | ||
| PLN02998 | PLN02998 | 9.0e-29 | 16 | 114 | 99 | + beta-glucosidase | ||
| PLN02814 | PLN02814 | 5.0e-29 | 2 | 86 | 85 | + beta-glucosidase | ||
| PLN02849 | PLN02849 | 6.0e-31 | 2 | 93 | 92 | + beta-glucosidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN81257.1 | 3.00004e-41 | 2 | 116 | 189 | 303 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI36851.1 | 7e-40 | 2 | 113 | 292 | 403 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002267643.1 | 8.99999e-40 | 2 | 113 | 411 | 522 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002268258.1 | 2e-39 | 1 | 108 | 297 | 404 | PREDICTED: hypothetical protein isoform 3 [Vitis vinifera] |
| RefSeq | XP_002523075.1 | 9.94922e-44 | 2 | 123 | 247 | 368 | beta-glucosidase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ptq_B | 9e-25 | 2 | 86 | 257 | 341 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3ptq_A | 9e-25 | 2 | 86 | 257 | 341 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3ptm_B | 9e-25 | 2 | 86 | 257 | 341 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3ptm_A | 9e-25 | 2 | 86 | 257 | 341 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3ptk_B | 9e-25 | 2 | 86 | 257 | 341 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DR993247 | 113 | 2 | 114 | 0 |
| CO417080 | 113 | 2 | 114 | 0 |
| CX025372 | 110 | 2 | 111 | 0 |
| FN732083 | 113 | 2 | 114 | 0 |
| CU657655 | 113 | 2 | 114 | 1.4013e-45 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Aquilegia coerulea | Aquca_003_00737.1 | ||||
| Brassica rapa | Bra006217 | Bra020858 | |||
| Medicago truncatula | Medtr8g038650.1 | ||||
| Prunus persica | ppb019447m | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |