CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000322418
FamilyGH9
Protein PropertiesLength: 454 Molecular Weight: 49700.6 Isoelectric Point: 9.0393
ChromosomeChromosome/Scaffold: 006631134 Start: 3170 End: 7364
Descriptionglycosyl hydrolase 9B1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH983010
  YVVXKGKPASEVSXEIAAALXASSMVFKDLDKAYSDSLLDRATQISTKDLTMIVLEKEHALFTVITVATRIXTNLKLDELIWGASWLCKATKDPNXXNYV
  KKQHKLFGVQCCGSFAEFGWDAKHAGINILVSQWVMTDRSSSNPFIPKADQFVCSILPESPVLKSVSYSPVYARYMKAASKVVDCGNNVHVTPTSLVNFT
  RTLVDYILGSNPSGMSYMVGFGQNYPXKIHHRGSVLPSMDQHPQHIDCNAGYSYFHGNDPNQNDLTGAVVGGPGEDDKYEDSRIDATKSEPTTS
Full Sequence
Protein Sequence     Length: 454     Download
MDTRRTSYVV XKGKPASEVS XEIAAALXAS SMVFKDLDKA YSDSLLDRAT QISTKDLTMI    60
VLEKEHALFT VITVATRIXT NLKLDELIWG ASWLCKATKD PNXXNYVKKQ HKLFGVQCCG    120
SFAEFGWDAK HAGINILVSQ WVMTDRSSSN PFIPKADQFV CSILPESPVL KSVSYSPVYA    180
RYMKAASKVV DCGNNVHVTP TSLVNFTRTL VDYILGSNPS GMSYMVGFGQ NYPXKIHHRG    240
SVLPSMDQHP QHIDCNAGYS YFHGNDPNQN DLTGAVVGGP GEDDKYEDSR IDATKSEPTT    300
SRSTKTKMQQ RRPASGRPTG TDGSDFXYRM VVDSRYQKVA KGKSLLYALI LTQAVVQLIG    360
VLYTFLSTSN GDGPDVIAIS SVAIGSISLI IGELGRRRSR VSLLKVYMVA SSVGILLSXA    420
CVAKGSLTLA DLQISSFWET KKFDLVEATR TVIG 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02613PLN026133.0e-551300336+
PLN02175PLN021754.0e-561300328+
PLN02266PLN022662.0e-641300337+
PLN02308PLN023081.0e-641300332+
PLN03009PLN030097.0e-671300324+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI24578.101300152469unnamed protein product [Vitis vinifera]
EMBLCBI24580.101300137451unnamed protein product [Vitis vinifera]
RefSeqXP_002321834.101300155473predicted protein [Populus trichocarpa]
RefSeqXP_002510937.101300155483endo-1,4-beta-glucanase, putative [Ricinus communis]
RefSeqXP_002510938.101300155484endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A3e-291300133415A Chain A, Crystal Structure Of Mandelate RacemaseMUCONATE LACTONIZING FAMILY Protein From Azoarcus Sp. Ebn1
PDB1ksc_A3e-291300133415A Chain A, Crystal Structure Of Mandelate RacemaseMUCONATE LACTONIZING FAMILY Protein From Azoarcus Sp. Ebn1
PDB1ks8_A3e-291300133415A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1ia7_A2e-174288139401A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1ia6_A2e-174288139401A Chain A, Crystal Structure Of The Cellulase Cel9m Of C. Cellulolyticum
Transmembrane Domains
StartEnd
344366
376394
401423
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO5412041483074540
DT762654240853000
DT762304240853000
HE6455291473084540
DT764772236893000
Orthologous Group
SpeciesID
Brachypodium distachyonBradi3g56870.1
Citrus sinensisorange1.1g019436m.12.195orange1.1g045046m.271.412orange1.1g045046m.271.412orange1.1g043973m
Fragaria vescamrna21630.1-v1.0-hybrid
Linum usitatissimumLus10025880.184.443Lus10025880.184.443Lus10010307.382.492Lus10010307.382.492
Malus domesticaMDP0000151410
Medicago truncatulaMedtr4g037140.1
Panicum virgatumPavirv00065976m
Picea abiesMA_107238g0010.352.456MA_107238g0010.352.456MA_10430095g0010.237.398MA_10430095g0010.237.398
Ricinus communis30131.m007125.321.42330131.m007125.321.42328865.m000016
Vitis viniferaGSVIVT01019379001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny