Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000379414 |
Family | CBM43 |
Protein Properties | Length: 182 Molecular Weight: 19201.6 Isoelectric Point: 9.5924 |
Chromosome | Chromosome/Scaffold: 004577447 Start: 198 End: 1242 |
Description | O-Glycosyl hydrolases family 17 protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 97 | 178 | 2.8e-32 |
WCVAKPGATDQALQSNIDYICGTGVDCKSVQPGGACFDNNVRARASYLMNTYYQANGLHDFNCDFSGSGQITTTDPSRGSCK |
Full Sequence |
---|
Protein Sequence Length: 182 Download |
MPNRKFETYI FALFNENQKP GPAAEKNWGL FKPDMTPVYN AGVMRNQQGG ATPGPTMKIP 60 TQPSTPAAPK SGKQGKPAKP AKPATPAAGG NNSGKKWCVA KPGATDQALQ SNIDYICGTG 120 VDCKSVQPGG ACFDNNVRAR ASYLMNTYYQ ANGLHDFNCD FSGSGQITTT DPSRGSCKYN 180 A* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00332 | Glyco_hydro_17 | 9.0e-15 | 1 | 40 | 40 | + Glycosyl hydrolases family 17. | ||
pfam07983 | X8 | 1.0e-21 | 96 | 165 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-37 | 96 | 179 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACM45718.1 | 0 | 1 | 181 | 293 | 454 | endo-1,3-beta-glucanase [Pyrus pyrifolia] |
EMBL | CAN83700.1 | 0 | 1 | 179 | 179 | 323 | hypothetical protein [Vitis vinifera] |
RefSeq | XP_002283647.1 | 0 | 1 | 179 | 301 | 445 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
RefSeq | XP_002283660.1 | 0 | 1 | 179 | 260 | 404 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
RefSeq | XP_002312097.1 | 0 | 1 | 180 | 302 | 448 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 1e-26 | 85 | 179 | 6 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
PDB | 1ghs_B | 0.000000004 | 6 | 40 | 269 | 303 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
PDB | 1ghs_A | 0.000000004 | 6 | 40 | 269 | 303 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
PDB | 4gzj_A | 0.0000002 | 2 | 39 | 273 | 310 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
PDB | 4gzi_A | 0.0000002 | 2 | 39 | 273 | 310 | A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase In Complex With Laminaratriose |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DR989789 | 182 | 1 | 182 | 0 |
GO557467 | 182 | 1 | 182 | 0 |
DT041970 | 170 | 1 | 170 | 0 |
EX669401 | 182 | 5 | 182 | 0 |
AM287826 | 169 | 25 | 182 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|