y
Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000399965 |
Family | AA2 |
Protein Properties | Length: 122 Molecular Weight: 13295 Isoelectric Point: 4.5 |
Chromosome | Chromosome/Scaffold: 000281228 Start: 12423 End: 13262 |
Description | ascorbate peroxidase 2 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 14 | 121 | 2.3e-28 |
SDHLRDVFGHMGLSDKEIVALSGGHTLGRCHKERSGFEGPWTTNPLIFDNSYFKELLNGEKEGLLQLPSDKALLEDPVFRPLVETYAADEDAFFADYAEA HLKLSELG |
Full Sequence |
---|
Protein Sequence Length: 122 Download |
MSLIISLCVG ALGSDHLRDV FGHMGLSDKE IVALSGGHTL GRCHKERSGF EGPWTTNPLI 60 FDNSYFKELL NGEKEGLLQL PSDKALLEDP VFRPLVETYA ADEDAFFADY AEAHLKLSEL 120 G* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00314 | plant_peroxidase_like | 9.0e-14 | 15 | 98 | 100 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
PLN02364 | PLN02364 | 5.0e-40 | 13 | 121 | 110 | + L-ascorbate peroxidase 1 | ||
PLN02879 | PLN02879 | 9.0e-43 | 13 | 121 | 109 | + L-ascorbate peroxidase | ||
PLN02608 | PLN02608 | 1.0e-45 | 12 | 121 | 110 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 3.0e-51 | 13 | 121 | 113 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABX79340.1 | 0 | 13 | 121 | 137 | 245 | cytosolic ascorbate peroxidase [Vitis vinifera] |
GenBank | ACM17463.1 | 0 | 13 | 121 | 137 | 245 | ascorbate peroxidase [Citrus maxima] |
EMBL | CAG27618.1 | 0 | 13 | 121 | 92 | 200 | putative ascorbate peroxidase [Populus x canadensis] |
EMBL | CAN59923.1 | 0 | 13 | 121 | 137 | 245 | hypothetical protein [Vitis vinifera] |
EMBL | CBI32625.1 | 0 | 13 | 121 | 137 | 245 | unnamed protein product [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3zcy_A | 0 | 13 | 121 | 136 | 245 | A Chain A, Ascorbate Peroxidase W41a-h42y Mutant |
PDB | 3zch_A | 0 | 13 | 121 | 148 | 257 | A Chain A, Ascorbate Peroxidase W41a-h42m Mutant |
PDB | 2wd4_A | 0 | 13 | 121 | 148 | 257 | A Chain A, Ascorbate Peroxidase W41a-h42m Mutant |
PDB | 2vo2_X | 0 | 13 | 121 | 148 | 257 | A Chain A, Ascorbate Peroxidase W41a-h42m Mutant |
PDB | 2vnz_X | 0 | 13 | 121 | 148 | 257 | A Chain A, Ascorbate Peroxidase W41a-h42m Mutant |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CV048305 | 112 | 10 | 121 | 1.4013e-45 |
CV052855 | 115 | 7 | 121 | 1.4013e-45 |
EX252078 | 109 | 13 | 121 | 5.60519e-45 |
EC994793 | 109 | 13 | 121 | 7.00649e-45 |
HE646230 | 109 | 13 | 121 | 9.80909e-45 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|