CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000405936
FamilyGT1
Protein PropertiesLength: 484 Molecular Weight: 52654.4 Isoelectric Point: 5.4651
ChromosomeChromosome/Scaffold: 02175632 Start: 6760 End: 8485
DescriptionUDP-glucosyl transferase 78D2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12624613.9e-39
  KLLNVGPSNVASPLPPLPPSDACLSWLDKQQAPSSVVYISFGTVASPAEKEQMAIAEALEATGAPFLWSIKDSCKTPLLNEFLTKTLSKLNGMVVPWAPQ
  PHVLAHDSVGAFVSHCGWNSIMETIAGRVPMICRPYFADQRLNARMVEEVFEIGVTVEDGVFTREGLVKSLEVVLSPESGRKFRDNIKRVKQLAVEAVGP
Full Sequence
Protein Sequence     Length: 484     Download
MAAPLPIEIE PSSTNGQPHL ADAYNRHVAV VAFPFTSHAS ALLETVRRLA TALPNTLFSF    60
FSTSKSNSSL FSNNSIDNMP RNIRVYDVAD GVPEGYVFVG KPQEDIELFM NAAPENIRRS    120
LDASVADIGK QISCLITDAF LWFGVHLADE LGVPWVTFWI SGLKSLSVHV HTDLIRDTIG    180
TQGITGREND LIVDKNVNIQ GLSNVRIKDL AEGVIFGNLD SVISGMLLQM GRLLPRATAV    240
FMNGFEELEL PIPNDLKSKV NKLLNVGPSN VASPLPPLPP SDACLSWLDK QQAPSSVVYI    300
SFGTVASPAE KEQMAIAEAL EATGAPFLWS IKDSCKTPLL NEFLTKTLSK LNGMVVPWAP    360
QPHVLAHDSV GAFVSHCGWN SIMETIAGRV PMICRPYFAD QRLNARMVEE VFEIGVTVED    420
GVFTREGLVK SLEVVLSPES GRKFRDNIKR VKQLAVEAVG PQGSSTRNFK SLLDIVSGSN    480
YQV* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02173PLN021732.0e-39115476387+
PLN02210PLN022103.0e-40100473397+
pfam00201UDPGT2.0e-4078454402+
PLN02555PLN025552.0e-47114474381+
PLN02448PLN024486.0e-4823477475+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD26203.1014831483AF117267_1 UDP glucose:flavonoid 3-O-glucosyl transferase [Malus x domestica]
GenBankAAU12367.102747711463flavonoid 3-O-glucosyltransferase [Fragaria x ananassa]
DDBJBAB93000.10344241391UDP glucose-flavonoid 3-O-glucosyltransferase [Malus x domestica]
DDBJBAF80946.102748011468UDP-glucose: anthocyanin 3-glucosylltransferase [Rosa hybrid cultivar]
DDBJBAI44431.1014831483putative UDP-galactose-flavonoid 3-O-galactosyltransferase [Malus x domestica]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2c9z_A0254777451A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB2c1z_A0254777451A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB2c1x_A0254777451A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbj_A02747715453A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbf_A02747715453A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO9046392202154340
CV5245582232614830
EB1289702131673790
GO521867211762860
CV0813012112154250
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_031_00073.1Aquca_031_00072.1
Arabidopsis lyrata488567326139313693488566
Arabidopsis thalianaAT5G17040.1AT1G30530.1AT5G17050.1AT5G17030.1
Brachypodium distachyonBradi1g46850.1
Brassica rapaBra023594
Carica papayaevm.model.supercontig_95.70
Capsella rubellaCarubv10000798m
Citrus clementinaCiclev10008258mCiclev10019770mCiclev10030331m
Citrus sinensisorange1.1g012893morange1.1g013878m
Cucumis sativusCucsa.092240.1Cucsa.089640.1
Eucalyptus grandisEucgr.A02964.3Eucgr.A02964.1Eucgr.E02976.1Eucgr.E02345.1Eucgr.I02607.1
Eucgr.E02973.1Eucgr.E02977.1Eucgr.C00191.1Eucgr.A02964.2Eucgr.E02398.1
Eucgr.C01022.1Eucgr.C00833.1Eucgr.A00303.1Eucgr.A00306.1Eucgr.C01021.1
Eucgr.C01020.1Eucgr.C01017.1Eucgr.D00702.1Eucgr.C00831.1Eucgr.L02741.1
Eucgr.L02520.1Eucgr.C01063.1Eucgr.E02978.1Eucgr.A00304.1
Fragaria vescamrna30947.1-v1.0-hybridmrna12591.1-v1.0-hybridmrna19962.1-v1.0-hybridmrna24693.1-v1.0-hybridmrna11466.1-v1.0-hybrid
mrna11467.1-v1.0-hybridmrna13747.1-v1.0-hybridmrna29614.1-v1.0-hybrid
Glycine maxGlyma07g30200.1Glyma13g01220.1Glyma07g30180.1Glyma08g07130.1Glyma07g30190.1
Glyma13g32910.1Glyma17g07341.1Glyma15g06390.1Glyma06g39350.2Glyma0060s00320.2
Gossypium raimondiiGorai.003G051800.1Gorai.004G101100.1Gorai.012G009400.1Gorai.012G009300.1Gorai.012G009500.1
Gorai.010G063400.1Gorai.009G050700.1Gorai.008G018000.1
Linum usitatissimumLus10025854
Malus domesticaMDP0000543445MDP0000638691MDP0000478252
Manihot esculentacassava4.1_007209mcassava4.1_031308mcassava4.1_033139mcassava4.1_028603m
Medicago truncatulaMedtr4g128690.1Medtr4g128720.1
Mimulus guttatusmgv1a006133mmgv1a006788m
Oryza sativaLOC_Os06g09240.1LOC_Os07g05420.1
Panicum virgatumPavirv00029337mPavirv00050970mPavirv00041516mPavirv00063020m
Phaseolus vulgarisPhvul.006G201100.1Phvul.002G214500.1Phvul.003G148300.1Phvul.002G214300.1Phvul.002G214400.1
Populus trichocarpaPotri.013G118700.1Potri.018G096000.1Potri.006G171100.1Potri.006G171200.1Potri.013G143900.1
Potri.009G133300.1Potri.009G078400.1Potri.019G090400.1
Prunus persicappa015939mppa019430mppa015221mppa017941mppa005162m
Ricinus communis28479.m00004729804.m00155830073.m002239
Setaria italicaSi006338mSi010039m
Selaginella moellendorffii105043445660
Sorghum bicolorSb10g006140.1Sb02g038860.1
Thellungiella halophilaThhalv10013472m
Vitis viniferaGSVIVT01037410001GSVIVT01037413001GSVIVT01029129001GSVIVT01029126001GSVIVT01029122001
GSVIVT01024419001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)