Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000418201 |
Family | GH19 |
Protein Properties | Length: 85 Molecular Weight: 9275.45 Isoelectric Point: 4.9503 |
Chromosome | Chromosome/Scaffold: 005501265 Start: 1417 End: 1671 |
Description | Chitinase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 1 | 77 | 4.9e-26 |
MTEQKPKPSSHDVMVGLYVPTEADVAANRTVGFGLVTNIINGGLECGIPNDARVNDWIGYFKRYAGLLNVDTKPNLD |
Full Sequence |
---|
Protein Sequence Length: 85 Download |
MTEQKPKPSS HDVMVGLYVP TEADVAANRT VGFGLVTNII NGGLECGIPN DARVNDWIGY 60 FKRYAGLLNV DTKPNLDYEN QKSF* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00182 | Glyco_hydro_19 | 1.0e-31 | 1 | 78 | 78 | + Chitinase class I. | ||
cd00325 | chitinase_glyco_hydro_19 | 1.0e-32 | 1 | 78 | 78 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004568 | chitinase activity |
GO:0006032 | chitin catabolic process |
GO:0016998 | cell wall macromolecule catabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAF00131.1 | 9.99995e-41 | 1 | 84 | 194 | 277 | AF147091_1 class II chitinase [Fragaria x ananassa] |
GenBank | ABQ42593.1 | 9.99995e-41 | 1 | 84 | 194 | 277 | chitinase [Fragaria x ananassa] |
GenBank | ABU55294.1 | 2e-40 | 1 | 84 | 194 | 277 | class II chitinase [Fragaria x ananassa] |
EMBL | CAA57773.1 | 1e-39 | 1 | 84 | 194 | 277 | chitinase (class II) [Arachis hypogaea] |
RefSeq | XP_002515175.1 | 4.00001e-41 | 1 | 84 | 191 | 274 | class I chitinase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4dyg_B | 4e-26 | 1 | 84 | 160 | 243 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 4dyg_A | 4e-26 | 1 | 84 | 160 | 243 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 4dwx_B | 4e-26 | 1 | 84 | 160 | 243 | A Chain A, Crystal Structure Of A Family Gh-19 Chitinase From Rye Seeds |
PDB | 4dwx_A | 4e-26 | 1 | 84 | 160 | 243 | A Chain A, Crystal Structure Of A Family Gh-19 Chitinase From Rye Seeds |
PDB | 3cql_B | 4e-26 | 1 | 84 | 159 | 242 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CU470705 | 85 | 1 | 85 | 6.99949e-42 |
FQ329722 | 85 | 1 | 85 | 9.99995e-41 |
FQ329411 | 85 | 1 | 85 | 2e-40 |
BP059286 | 85 | 1 | 85 | 4.00001e-40 |
AV767012 | 85 | 1 | 85 | 5e-40 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|