y
Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000420628 |
Family | CE8 |
Protein Properties | Length: 116 Molecular Weight: 13186 Isoelectric Point: 9.8033 |
Chromosome | Chromosome/Scaffold: 017306113 Start: 138 End: 1004 |
Description | pectin methylesterase 44 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE8 | 10 | 94 | 1.80067e-42 |
QGFIARDITFENTAGPQKHQAVALRSDSDLSVFNRCQTRGYQDTLYAHTMRQFYRDCKISSTVDFIFGDATVVFQNCQILAKKGY |
Full Sequence |
---|
Protein Sequence Length: 116 Download |
MGVYKVCEWQ GFIARDITFE NTAGPQKHQA VALRSDSDLS VFNRCQTRGY QDTLYAHTMR 60 QFYRDCKISS TVDFIFGDAT VVFQNCQILA KKGYGIRRTA SQPKAGRTRM SRPEF* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02916 | PLN02916 | 4.0e-43 | 11 | 92 | 82 | + pectinesterase family protein | ||
PLN02314 | PLN02314 | 2.0e-43 | 10 | 88 | 79 | + pectinesterase | ||
PLN02301 | PLN02301 | 1.0e-44 | 11 | 92 | 82 | + pectinesterase/pectinesterase inhibitor | ||
PLN02201 | PLN02201 | 4.0e-56 | 10 | 93 | 84 | + probable pectinesterase/pectinesterase inhibitor | ||
pfam01095 | Pectinesterase | 1.0e-56 | 10 | 93 | 84 | + Pectinesterase. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0005618 | cell wall |
GO:0030599 | pectinesterase activity |
GO:0042545 | cell wall modification |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAQ21124.1 | 7.00649e-44 | 10 | 93 | 285 | 368 | pectinesterase [Fragaria x ananassa] |
DDBJ | BAF42041.1 | 0 | 10 | 93 | 282 | 365 | pectin methylesterase 4 [Pyrus communis] |
Swiss-Prot | Q43062 | 0 | 10 | 93 | 294 | 377 | PME_PRUPE RecName: Full=Pectinesterase/pectinesterase inhibitor PPE8B; Includes: RecName: Full=Pectinesterase inhibitor PPE8B; AltName: Full=Pectin methylesterase inhibitor PPE8B; Includes: RecName: Full=Pectinesterase PPE8B; Short=PE PPE8B; AltName: Full=Pectin methylesterase PPE8B; Flags: Precursor |
RefSeq | XP_002326321.1 | 7.00649e-44 | 10 | 93 | 293 | 376 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002516191.1 | 2.94273e-44 | 10 | 93 | 72 | 155 | Pectinesterase PPE8B precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1xg2_A | 8e-33 | 10 | 92 | 90 | 172 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 1gq8_A | 2e-30 | 11 | 92 | 95 | 176 | A Chain A, Pectin Methylesterase From Carrot |
PDB | 1qjv_B | 0.0000000000002 | 29 | 91 | 129 | 193 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
PDB | 1qjv_A | 0.0000000000002 | 29 | 91 | 129 | 193 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
PDB | 2ntq_B | 0.0000000000002 | 29 | 91 | 129 | 193 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CN994197 | 84 | 10 | 93 | 0 |
BU048816 | 84 | 10 | 93 | 0 |
GO497869 | 84 | 10 | 93 | 0 |
GO497869 | 24 | 91 | 114 | 0.0008 |
CN994197 | 24 | 91 | 114 | 0.002 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Malus domestica | MDP0000453813 |