Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000421802 |
Family | GH19 |
Protein Properties | Length: 212 Molecular Weight: 22520.1 Isoelectric Point: 7.904 |
Chromosome | Chromosome/Scaffold: 015346226 Start: 299 End: 2416 |
Description | basic chitinase |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 93 | 210 | 1.3999e-42 |
VSSLVSSSVFDQMLKYRNDGRCPSNGFYKYDAFIAAARSFNGFGTTGDVATRKKELAAFLAQTSHETTGGWASAPDGPYAWGYCFVNEKNQDVYCTPSSQ YPCAAGKKYYGRGPIQLT |
Full Sequence |
---|
Protein Sequence Length: 212 Download |
MHKALCSESS IKRALCPNFI DFQDLDKFNK LRISAEQCGS QAGGAVCPNG LCCSQFGWCG 60 TTSDYCAAGC QSQCSSTPKP TPTPTPSGGG GDVSSLVSSS VFDQMLKYRN DGRCPSNGFY 120 KYDAFIAAAR SFNGFGTTGD VATRKKELAA FLAQTSHETT GGWASAPDGP YAWGYCFVNE 180 KNQDVYCTPS SQYPCAAGKK YYGRGPIQLT Q* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
smart00270 | ChtBD1 | 2.0e-13 | 37 | 74 | 38 | + Chitin binding domain. |
pfam00187 | Chitin_bind_1 | 6.0e-15 | 37 | 74 | 38 | + Chitin recognition protein. |
cd06921 | ChtBD1_GH19_hevein | 4.0e-15 | 36 | 74 | 39 | + Hevein or Type 1 chitin binding domain subfamily co-occuring with family 19 glycosyl hydrolases or with barwin domains. This subfamily includes Hevein, a major IgE-binding allergen in natural rubber latex. ChtBD1 is a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements. |
cd00325 | chitinase_glyco_hydro_19 | 1.0e-58 | 102 | 210 | 109 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. |
pfam00182 | Glyco_hydro_19 | 2.0e-63 | 102 | 210 | 110 | + Chitinase class I. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004568 | chitinase activity |
GO:0006032 | chitin catabolic process |
GO:0008061 | chitin binding |
GO:0016998 | cell wall macromolecule catabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAF17593.1 | 0 | 31 | 211 | 19 | 198 | AF202731_1 chitinase class I [Glycine max] |
GenBank | ABD66068.1 | 0 | 34 | 211 | 19 | 192 | chitinase [Momordica charantia] |
GenBank | ACJ38195.1 | 0 | 33 | 211 | 17 | 194 | chitinase [Malus hupehensis] |
GenBank | ACM45713.1 | 0 | 35 | 211 | 19 | 195 | class I chitinase [Pyrus pyrifolia] |
Swiss-Prot | P36907 | 0 | 11 | 211 | 1 | 198 | CHIX_PEA RecName: Full=Endochitinase; Flags: Precursor |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3iwr_B | 0 | 36 | 210 | 2 | 176 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
PDB | 3iwr_A | 0 | 36 | 210 | 2 | 176 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
PDB | 2dkv_A | 0 | 36 | 210 | 2 | 176 | A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa L. Japonica |
PDB | 3cql_B | 0 | 93 | 210 | 2 | 120 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 3cql_A | 0 | 93 | 210 | 2 | 120 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EB128381 | 179 | 33 | 211 | 0 |
EB142545 | 177 | 35 | 211 | 0 |
DR990719 | 179 | 33 | 211 | 0 |
FC865307 | 177 | 35 | 211 | 0 |
FC864188 | 177 | 35 | 211 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|