| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000453813 |
| Family | CE8 |
| Protein Properties | Length: 116 Molecular Weight: 13203.8 Isoelectric Point: 9.8033 |
| Chromosome | Chromosome/Scaffold: 005857202 Start: 2167 End: 3034 |
| Description | pectin methylesterase 44 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CE8 | 10 | 94 | 7.79963e-42 |
| QGFIARDITFENXAGPQKHQAVALRSDSDLSVFNRCQTRGYQDTLYAHTMRQFYRDCKISSTVDFIFGDATVVFQNCQILAKKGY | |||
| Full Sequence |
|---|
| Protein Sequence Length: 116 Download |
| MGVYKVCEWQ GFIARDITFE NXAGPQKHQA VALRSDSDLS VFNRCQTRGY QDTLYAHTMR 60 QFYRDCKISS TVDFIFGDAT VVFQNCQILA KKGYGIRRTA SQPKAGRTRM SRPEF* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02916 | PLN02916 | 2.0e-42 | 11 | 92 | 82 | + pectinesterase family protein | ||
| PLN02314 | PLN02314 | 1.0e-42 | 10 | 88 | 79 | + pectinesterase | ||
| PLN02301 | PLN02301 | 1.0e-43 | 11 | 92 | 82 | + pectinesterase/pectinesterase inhibitor | ||
| PLN02201 | PLN02201 | 3.0e-55 | 10 | 93 | 84 | + probable pectinesterase/pectinesterase inhibitor | ||
| pfam01095 | Pectinesterase | 1.0e-55 | 10 | 93 | 84 | + Pectinesterase. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAF42041.1 | 0 | 10 | 93 | 282 | 365 | pectin methylesterase 4 [Pyrus communis] |
| Swiss-Prot | Q43062 | 0 | 10 | 93 | 294 | 377 | PME_PRUPE RecName: Full=Pectinesterase/pectinesterase inhibitor PPE8B; Includes: RecName: Full=Pectinesterase inhibitor PPE8B; AltName: Full=Pectin methylesterase inhibitor PPE8B; Includes: RecName: Full=Pectinesterase PPE8B; Short=PE PPE8B; AltName: Full=Pectin methylesterase PPE8B; Flags: Precursor |
| RefSeq | XP_002270616.1 | 2.99878e-43 | 10 | 93 | 304 | 387 | PREDICTED: pectin methylesterase PME1 [Vitis vinifera] |
| RefSeq | XP_002326321.1 | 2.99878e-43 | 10 | 93 | 293 | 376 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002516191.1 | 2.00386e-43 | 10 | 93 | 72 | 155 | Pectinesterase PPE8B precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1xg2_A | 5e-32 | 10 | 92 | 90 | 172 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 1gq8_A | 2e-29 | 11 | 92 | 95 | 176 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 2ntq_B | 0.0000000000002 | 29 | 91 | 129 | 193 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 2ntq_A | 0.0000000000002 | 29 | 91 | 129 | 193 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 2ntp_B | 0.0000000000002 | 29 | 91 | 129 | 193 | A Chain A, Pectin Methylesterase From Carrot |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CN994197 | 84 | 10 | 93 | 0 |
| BU048816 | 84 | 10 | 93 | 0 |
| GO497869 | 84 | 10 | 93 | 0 |
| GO497869 | 24 | 91 | 114 | 0.0008 |
| CN994197 | 24 | 91 | 114 | 0.002 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Malus domestica | MDP0000420628 | ||||
| Sequence Alignments |
|---|
 |
| Phylogeny |
|---|
 |