| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000460020 |
| Family | CE8 |
| Protein Properties | Length: 129 Molecular Weight: 13983.8 Isoelectric Point: 7.5124 |
| Chromosome | Chromosome/Scaffold: 008873441 Start: 2058 End: 2488 |
| Description | Plant invertase/pectin methylesterase inhibitor superfamily |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 53 | 121 | 3.7e-23 |
| LVVAKDGTGNFTTISEAVDVAPNSCATRFVIYIKAGAYFENVEVVKKKTNLMFLGDGIGNTIVKASWNV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 129 Download |
| MAESALQLVS EIDTHLRRQT HPNKDSIVKS LRQAGSALSQ LLQSSTNETK YDLVVAKDGT 60 GNFTTISEAV DVAPNSCATR FVIYIKAGAY FENVEVVKKK TNLMFLGDGI GNTIVKASWN 120 VVDGWTTF* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02313 | PLN02313 | 1.0e-25 | 50 | 128 | 79 | + Pectinesterase/pectinesterase inhibitor | ||
| PLN02301 | PLN02301 | 1.0e-28 | 50 | 128 | 79 | + pectinesterase/pectinesterase inhibitor | ||
| PLN02201 | PLN02201 | 2.0e-29 | 46 | 128 | 83 | + probable pectinesterase/pectinesterase inhibitor | ||
| PLN02933 | PLN02933 | 3.0e-35 | 47 | 128 | 82 | + Probable pectinesterase/pectinesterase inhibitor | ||
| pfam01095 | Pectinesterase | 3.0e-36 | 52 | 128 | 77 | + Pectinesterase. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACQ85264.1 | 1e-35 | 40 | 128 | 241 | 329 | pectin methylesterase [Musa acuminata AAA Group] |
| RefSeq | NP_192139.1 | 1e-30 | 40 | 128 | 209 | 297 | pectinesterase family protein [Arabidopsis thaliana] |
| RefSeq | NP_192141.1 | 5e-31 | 41 | 128 | 196 | 283 | pectinesterase family protein [Arabidopsis thaliana] |
| RefSeq | XP_002301486.1 | 4e-37 | 40 | 128 | 126 | 214 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002523113.1 | 4e-37 | 40 | 128 | 233 | 321 | Pectinesterase-3 precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 2e-22 | 52 | 128 | 8 | 84 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 5e-21 | 54 | 128 | 6 | 80 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CN880349 | 83 | 46 | 128 | 0 |
| CA799897 | 82 | 47 | 128 | 1.99993e-41 |
| CK606135 | 82 | 47 | 128 | 2e-40 |
| FG910555 | 82 | 47 | 128 | 3e-40 |
| BF067488 | 82 | 47 | 128 | 3e-40 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |